DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and UBC27

DIOPT Version :10

Sequence 1:NP_524230.2 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001190508.1 Gene:UBC27 / 835159 AraportID:AT5G50870 Length:203 Species:Arabidopsis thaliana


Alignment Length:179 Identity:59/179 - (32%)
Similarity:88/179 - (49%) Gaps:37/179 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MRDFKRLQED--------PPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNK 66
            |.||.|:|::        ..:|:...|..:|:......|.||..||:|.|||::.|...:.||.:
plant     1 MIDFSRIQKELQDCERNQDSSGIRVCPKSDNLTRLTGTIPGPIGTPYEGGTFQIDITMPDGYPFE 65

  Fly    67 PPTVRFVSKVFHPNVYA-DGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQ-- 128
            ||.::|.:||:|||:.: .|.||||||:::|||...:...|.|||:|||.|.|..|.::..|:  
plant    66 PPKMQFSTKVWHPNISSQSGAICLDILKDQWSPALTLKTALVSIQALLSAPEPKDPQDAVVAEQV 130

  Fly   129 --LYKENRREY------------------------EKRVKACVEQSFID 151
              |:..|...|                        |::||..||..|.|
plant   131 LLLHHLNHLRYMKNYQVFVSTARYWTETFAKKSSLEEKVKRLVEMGFGD 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_524230.2 UBCc_UBE2A_2B 3..145 CDD:467410 55/171 (32%)
UBC27NP_001190508.1 UBCc_UBE2K 4..158 CDD:467420 50/153 (33%)
UBA_II_E2_UBC27_like 166..201 CDD:270497 7/14 (50%)

Return to query results.
Submit another query.