DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and RCE1

DIOPT Version :10

Sequence 1:NP_524230.2 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_568008.4 Gene:RCE1 / 829833 AraportID:AT4G36800 Length:184 Species:Arabidopsis thaliana


Alignment Length:143 Identity:39/143 - (27%)
Similarity:76/143 - (53%) Gaps:1/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRF 72
            ||.:|...|.......:|.....:::|.:. |...|.|..:.:|||..|.:.:..||::.|.|:.
plant    34 RLHKDISELNLPSSCSISFPNGKDDLMNFE-VSIKPDDGYYHNGTFVFTFQVSPVYPHEAPKVKC 97

  Fly    73 VSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRREY 137
            .:||:|||:..:|.:||:||:..|.|..:::.::..:..|.::||...|.|..||.:.::|.:.:
plant    98 KTKVYHPNIDLEGNVCLNILREDWKPVLNINTVIYGLFHLFTEPNSEDPLNHDAAAVLRDNPKLF 162

  Fly   138 EKRVKACVEQSFI 150
            |..|:..:...::
plant   163 ETNVRRAMTGGYV 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_524230.2 UBCc_UBE2A_2B 3..145 CDD:467410 39/136 (29%)
RCE1NP_568008.4 UBCc_UBE2F_UBE2M 30..168 CDD:467414 39/134 (29%)

Return to query results.
Submit another query.