DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and FUS9

DIOPT Version :10

Sequence 1:NP_524230.2 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_566459.2 Gene:FUS9 / 820557 AraportID:AT3G13550 Length:182 Species:Arabidopsis thaliana


Alignment Length:136 Identity:50/136 - (36%)
Similarity:79/136 - (58%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVR 71
            :|:.|:...|..|||...|..|..:|:..|.|.|.||..||:|.|.|.|.|.|..:||.|||.:.
plant    39 KRIQREMAELNIDPPPDCSAGPKGDNLYHWIATIIGPSGTPYEGGIFFLDIIFPSDYPFKPPKLV 103

  Fly    72 FVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRRE 136
            |.::::|.||...|.:.::||::.|||...::.:|.:|:|:...|.|.|||....|:||..:|.:
plant   104 FKTRIYHCNVDTAGDLSVNILRDSWSPALTITKVLQAIRSIFLKPEPYSPALPVIARLYLTDREK 168

  Fly   137 YEKRVK 142
            :::..|
plant   169 HDEVAK 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_524230.2 UBCc_UBE2A_2B 3..145 CDD:467410 50/136 (37%)
FUS9NP_566459.2 UBCc_UEV 39..179 CDD:483950 50/136 (37%)

Return to query results.
Submit another query.