DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and AT2G32790

DIOPT Version :9

Sequence 1:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_565754.1 Gene:AT2G32790 / 817840 AraportID:AT2G32790 Length:177 Species:Arabidopsis thaliana


Alignment Length:142 Identity:51/142 - (35%)
Similarity:84/142 - (59%) Gaps:5/142 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTPARRRLMRDFKRLQEDPPTGV---SGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEE 62
            :|..|..||.::|:  ::|....:   |..|:..||..|.|.:.||...|:|.|.|.:::....:
plant    26 VSKSAENRLWKEFQ--EKDDVLKIHVRSWLPSPENIFRWEATVNGPVGCPYEKGVFTVSVHIPPK 88

  Fly    63 YPNKPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAA 127
            ||.:||.:.|.:|:||||:...|.|.:|||.:|||....::.:|.||.|:||:|......::.||
plant    89 YPYEPPKITFKTKIFHPNISEIGEIFVDILGSRWSSALTINLVLLSICSILSNPVEPLLVSNHAA 153

  Fly   128 QLYKENRREYEK 139
            :||:::|:.|||
plant   154 RLYQKDRKAYEK 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 49/135 (36%)
AT2G32790NP_565754.1 UQ_con 33..171 CDD:395127 49/135 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.