DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and UBC2

DIOPT Version :9

Sequence 1:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001325162.1 Gene:UBC2 / 814805 AraportID:AT2G02760 Length:152 Species:Arabidopsis thaliana


Alignment Length:149 Identity:113/149 - (75%)
Similarity:137/149 - (91%) Gaps:0/149 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPN 65
            ||||||:||||||||||:|||.|:||||.|||||:||||||||.|||::.|||||:::|:|:|||
plant     1 MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPN 65

  Fly    66 KPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLY 130
            |||||||||::||||:||||.||||||||:|||.|||:||||||||||.||||||||||.||:::
plant    66 KPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMF 130

  Fly   131 KENRREYEKRVKACVEQSF 149
            .|::|||.:||:..||||:
plant   131 SESKREYNRRVREVVEQSW 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 103/136 (76%)
UBC2NP_001325162.1 UBCc 7..145 CDD:238117 103/137 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 236 1.000 Domainoid score I616
eggNOG 1 0.900 - - E2759_KOG0419
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 254 1.000 Inparanoid score I1012
OMA 1 1.010 - - QHG54755
OrthoDB 1 1.010 - - D1292821at2759
OrthoFinder 1 1.000 - - FOG0001694
OrthoInspector 1 1.000 - - otm2650
orthoMCL 1 0.900 - - OOG6_101178
Panther 1 1.100 - - O PTHR24067
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1087
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.