DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and Ube2g1

DIOPT Version :9

Sequence 1:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_073181.1 Gene:Ube2g1 / 64631 RGDID:620392 Length:170 Species:Rattus norvegicus


Alignment Length:155 Identity:57/155 - (36%)
Similarity:93/155 - (60%) Gaps:15/155 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LMRDFKRLQEDPPTGVS-GAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRF 72
            |.|....|.::|..|.| |...||::..|..:|.||.||.:|.|.||..:.|.::||.:||.::|
  Rat    10 LRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKF 74

  Fly    73 VSKVFHPNVYADGGICLDIL-------------QNRWSPTYDVSAILTSIQSLLSDPNPNSPANS 124
            :::::||||..:|.:|:.||             :.||.|.:.|..|:.|:.|:|:|||.:||||.
  Rat    75 ITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANV 139

  Fly   125 TAAQLYKENRR-EYEKRVKACVEQS 148
            .||:.::|:|. |::::|..||.:|
  Rat   140 DAAKEWREDRNGEFKRKVARCVRKS 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 54/150 (36%)
Ube2g1NP_073181.1 UQ_con 10..161 CDD:395127 54/150 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.