DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and BIRC6

DIOPT Version :9

Sequence 1:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_005264507.2 Gene:BIRC6 / 57448 HGNCID:13516 Length:4880 Species:Homo sapiens


Alignment Length:173 Identity:51/173 - (29%)
Similarity:81/173 - (46%) Gaps:27/173 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STPARRRLMRDFKRLQEDPPTGVSGAP----TDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEE 62
            |....|||.::...|....|...|.:.    .:..:.|...:|.||.|||:.:|.|:..:.|.::
Human  4594 SAARARRLAQEAVTLSTSLPLSSSSSVFVRCDEERLDIMKVLITGPADTPYANGCFEFDVYFPQD 4658

  Fly    63 YPNKPPTVRFV-----SKVFHPNVYADGGICLDIL-------QNRWSP-TYDVSAILTSIQSLL- 113
            ||:.||.|...     |..|:||:|.||.:||.||       :.:|:| |.....:|.|:|||: 
Human  4659 YPSSPPLVNLETTGGHSVRFNPNLYNDGKVCLSILNTWHGRPEEKWNPQTSSFLQVLVSVQSLIL 4723

  Fly   114 -SDPNPNSPA--NSTAAQLYKENRREYEKRVK------ACVEQ 147
             ::|..|.|.  .|.......::.|||:..::      |.:||
Human  4724 VAEPYFNEPGYERSRGTPSGTQSSREYDGNIRQATVKWAMLEQ 4766

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 47/163 (29%)
BIRC6XP_005264507.2 BIR 287..360 CDD:237989
DUF3643 3489..3641 CDD:289152
UBCc 4620..4758 CDD:238117 41/137 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.