DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and Ube2u

DIOPT Version :9

Sequence 1:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_006238505.1 Gene:Ube2u / 500511 RGDID:1565480 Length:337 Species:Rattus norvegicus


Alignment Length:141 Identity:49/141 - (34%)
Similarity:75/141 - (53%) Gaps:3/141 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRFV 73
            |.|:||.||.....|::..|..:::|.|.|.|.|...:..|...|.|||:|:::|...||.|:||
  Rat    19 LEREFKELQNSRSKGINAYPVSSDLMSWKAEIEGLKYSVCEGLVFHLTIDFSQDYNLVPPVVKFV 83

  Fly    74 SKVFHPNVYA-DGGICLDILQ--NRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRR 135
            :..|||||:. .|...|.||.  :.|..:|.:..||..:|.|||.|...:|.|..||:|..::..
  Rat    84 TIPFHPNVHPYTGQPSLGILDKPDMWDTSYTILRILFDLQMLLSYPMVKNPLNLEAAELLVKDES 148

  Fly   136 EYEKRVKACVE 146
            .|...::..::
  Rat   149 LYRTVIRELLQ 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 49/138 (36%)
Ube2uXP_006238505.1 COG5078 13..156 CDD:227410 49/136 (36%)
UBCc 16..156 CDD:238117 49/136 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0419
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.