DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and ube2z

DIOPT Version :9

Sequence 1:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001007969.2 Gene:ube2z / 493338 XenbaseID:XB-GENE-990986 Length:313 Species:Xenopus tropicalis


Alignment Length:175 Identity:54/175 - (30%)
Similarity:85/175 - (48%) Gaps:31/175 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRF 72
            |:.||...:.::||.|:...|..:::...:|:|.||.|||:|.|.|........:||..||.|:.
 Frog    62 RIKRDIMSIYKEPPPGMFVVPDPHDMTKIHALITGPFDTPYEGGFFLFLFRCPPDYPIHPPRVKL 126

  Fly    73 VSK-----VFHPNVYADGGICLDILQN----RWSPTYDVSAILTSIQSLLSD-PNPNSPA----- 122
            ::.     .|:||.|.:|.:||.||..    .|||...:|::|.|||||::: |..|.|.     
 Frog   127 MTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSLSSVLISIQSLMTENPYHNEPGFEQER 191

  Fly   123 NSTAAQLYKENRREYEKRVKAC----------------VEQSFID 151
            :|..::.|.|..|....||..|                :|:||::
 Frog   192 HSGDSKNYNECIRHETIRVAVCEMLEGKCQCPDALRSVMEKSFME 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 51/167 (31%)
ube2zNP_001007969.2 UBCc 62..207 CDD:238117 48/144 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..313
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.