DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and CG46338

DIOPT Version :9

Sequence 1:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_524888.1 Gene:CG46338 / 47272 FlyBaseID:FBgn0285962 Length:244 Species:Drosophila melanogaster


Alignment Length:164 Identity:38/164 - (23%)
Similarity:72/164 - (43%) Gaps:36/164 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKP--PTV 70
            :::.::|.::.:..:|:...|:..|.:.|..|.||.... :.:..|:.||...:.:|:..  |::
  Fly    24 KILAEYKMIESEKLSGIYVIPSYANSLQWFGVFFGRQGL-YAESVFRFTILLPDRFPDDKSLPSI 87

  Fly    71 RFVSKVFHPNVYADGGICLDILQNRWSPTYDVS--------------AILTSIQSLLSDP----- 116
            .|...|.||:|      |      .::.:.|||              .:|..:|.:.|||     
  Fly    88 IFQQDVIHPHV------C------PYTHSLDVSHAFPEWRCGEDHLWQLLKYLQVIFSDPLDSIR 140

  Fly   117 --NPNSPANSTAAQLYKENRREYEKRVKACVEQS 148
              ..:...||.||:|...|:.||..||:..:::|
  Fly   141 GIEVDKLKNSEAAELLMNNKEEYVARVQENIKES 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 37/159 (23%)
CG46338NP_524888.1 UBCc 19..169 CDD:294101 37/157 (24%)
COG5078 24..176 CDD:227410 38/164 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438066
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24067
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.