DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and ube2b

DIOPT Version :9

Sequence 1:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001005124.1 Gene:ube2b / 448706 XenbaseID:XB-GENE-1003709 Length:152 Species:Xenopus tropicalis


Alignment Length:151 Identity:131/151 - (86%)
Similarity:141/151 - (93%) Gaps:0/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPN 65
            |||||||||||||||||||||.||||||::||||:||||||||..||||||||||.|||:|||||
 Frog     1 MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLVIEFSEEYPN 65

  Fly    66 KPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLY 130
            ||||||||||:|||||||||.|||||||||||||||||:|||||||||.:|||||||||.|||||
 Frog    66 KPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLY 130

  Fly   131 KENRREYEKRVKACVEQSFID 151
            :||:|||||||.|.||||:.|
 Frog   131 QENKREYEKRVSAIVEQSWND 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 119/136 (88%)
ube2bNP_001005124.1 UQ_con 8..145 CDD:395127 119/136 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 259 1.000 Domainoid score I1953
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 281 1.000 Inparanoid score I2828
OMA 1 1.010 - - QHG54755
OrthoDB 1 1.010 - - D1292821at2759
OrthoFinder 1 1.000 - - FOG0001694
OrthoInspector 1 1.000 - - otm48197
Panther 1 1.100 - - O PTHR24067
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1583
SonicParanoid 1 1.000 - - X1087
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.