DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and Ubc7

DIOPT Version :9

Sequence 1:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001285334.1 Gene:Ubc7 / 44054 FlyBaseID:FBgn0267384 Length:167 Species:Drosophila melanogaster


Alignment Length:162 Identity:61/162 - (37%)
Similarity:90/162 - (55%) Gaps:14/162 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTPARRRLMRDFKRLQEDPPTGVSGAP-TDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYP 64
            |:..|.||||.::|:|..|||.|:...| :::|...|.|:|.||..|.||.|.|...:.|..:||
  Fly     1 MAGSALRRLMAEYKQLTLDPPEGIVAGPISEDNFFEWEALIAGPEGTCFEGGVFPARLIFPTDYP 65

  Fly    65 NKPPTVRFVSKVFHPNVYADGGICLDILQ-------------NRWSPTYDVSAILTSIQSLLSDP 116
            ..||.::|...:||||::|||.:|:.||.             .||||...|..||.|:.|:|::|
  Fly    66 LSPPKMKFTCDMFHPNIFADGRVCISILHAPGDDPMGYELSAERWSPVQSVEKILLSVVSMLAEP 130

  Fly   117 NPNSPANSTAAQLYKENRREYEKRVKACVEQS 148
            |..|.||..||.:::|.|.|:....:..|.::
  Fly   131 NDESGANVDAAIMWREQRDEFNAIARRLVRKT 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 57/150 (38%)
Ubc7NP_001285334.1 COG5078 1..163 CDD:227410 61/162 (38%)
UQ_con 8..159 CDD:278603 57/150 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438065
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24067
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.