DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and ube2b

DIOPT Version :9

Sequence 1:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001002747.1 Gene:ube2b / 437020 ZFINID:ZDB-GENE-040718-247 Length:152 Species:Danio rerio


Alignment Length:151 Identity:131/151 - (86%)
Similarity:142/151 - (94%) Gaps:0/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPN 65
            |||.||||||||||||||||||||||||::||||:||||||||..||||||||||.|||:|||||
Zfish     1 MSTQARRRLMRDFKRLQEDPPTGVSGAPSENNIMLWNAVIFGPVGTPFEDGTFKLVIEFSEEYPN 65

  Fly    66 KPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLY 130
            ||||||||||:|||||||||.|||||||||||||||||:|||||||||.:|||||||||.|||||
Zfish    66 KPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLY 130

  Fly   131 KENRREYEKRVKACVEQSFID 151
            :||:|||||||.|.||||::|
Zfish   131 QENKREYEKRVSAVVEQSWVD 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 120/136 (88%)
ube2bNP_001002747.1 COG5078 1..151 CDD:227410 130/149 (87%)
UQ_con 8..145 CDD:278603 120/136 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579029
Domainoid 1 1.000 259 1.000 Domainoid score I1948
eggNOG 1 0.900 - - E2759_KOG0419
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 281 1.000 Inparanoid score I2871
OMA 1 1.010 - - QHG54755
OrthoDB 1 1.010 - - D1292821at2759
OrthoFinder 1 1.000 - - FOG0001694
OrthoInspector 1 1.000 - - otm24400
orthoMCL 1 0.900 - - OOG6_101178
Panther 1 1.100 - - O PTHR24067
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1583
SonicParanoid 1 1.000 - - X1087
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.