DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and CG7656

DIOPT Version :9

Sequence 1:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster


Alignment Length:161 Identity:62/161 - (38%)
Similarity:91/161 - (56%) Gaps:20/161 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STPARRRLMRDFKRLQEDPPTGVS-GAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPN 65
            |:.|.|.|..::|.|||:|..|.. ....|:|:..|...||||.||.::.|.||..::|..:||.
  Fly    38 SSSAVRALAMEYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYPY 102

  Fly    66 KPPTVRFVSKVFHPNVYADGGICLDILQ-------------NRWSPTYDVSAILTSIQSLLSDPN 117
            .||::||::||:|||||.:|.:|:.||.             .||:||.:|..||.|:.|||::||
  Fly   103 SPPSIRFLTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLLNEPN 167

  Fly   118 PNSPANSTAAQLYKENR------REYEKRVK 142
            ..||||..|:.:|:..|      .||...::
  Fly   168 TFSPANVDASVMYRRWRDSQGKDNEYPNIIR 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 59/155 (38%)
CG7656NP_648783.4 UBCc 42..186 CDD:238117 58/143 (41%)
COG5078 45..182 CDD:227410 56/136 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438074
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24067
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.