DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and ube2m

DIOPT Version :10

Sequence 1:NP_524230.2 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_988956.1 Gene:ube2m / 394553 XenbaseID:XB-GENE-1005525 Length:183 Species:Xenopus tropicalis


Alignment Length:149 Identity:41/149 - (27%)
Similarity:83/149 - (55%) Gaps:2/149 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNK 66
            ::.|:.|:.:|...|  :.|.......:|::.::...::..|.:..::.|.|..:.:..:.||:.
 Frog    27 ASAAQLRIQKDINEL--NLPKTCEIEFSDHDDLLNFKLVICPDEGFYKGGKFVFSFKVGQGYPHD 89

  Fly    67 PPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYK 131
            ||.|:..:.|:|||:..:|.:||:||:..|.|...:::|:..:|.|..:|||..|.|..||::.:
 Frog    90 PPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQ 154

  Fly   132 ENRREYEKRVKACVEQSFI 150
            .|||.:|:.|:..:...:|
 Frog   155 NNRRLFEQNVQRSMRGGYI 173

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_524230.2 UBCc_UBE2A_2B 3..145 CDD:467410 40/141 (28%)