DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and UbcE2M

DIOPT Version :9

Sequence 1:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001261567.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster


Alignment Length:155 Identity:48/155 - (30%)
Similarity:87/155 - (56%) Gaps:7/155 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNK 66
            ::.|:.|:.:|...|.. |.|..:..|..|:::.:..:| .|.:..:.||.|.........||::
  Fly    24 ASAAQLRIQKDINELNL-PNTCATDFPDPNDLLNFKLII-SPDEGFYRDGRFVFNFRVGSNYPHE 86

  Fly    67 PPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYK 131
            ||.|:..::|:|||:..||.:||:||:..|:|..::::|:..:|.|..:|||..|.|..||.:.:
  Fly    87 PPKVKCATQVYHPNIDLDGNVCLNILREDWNPVLNINSIVYGLQFLFLEPNPEDPLNKEAADVLQ 151

  Fly   132 ENRREYEKRVK-----ACVEQSFID 151
            .|||::|..||     .||.:::.:
  Fly   152 TNRRQFENNVKKAMRGGCVGETYFE 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 45/141 (32%)
UbcE2MNP_001261567.1 UQ_con 30..165 CDD:395127 45/136 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438070
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.