DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and Ube2u

DIOPT Version :9

Sequence 1:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001028945.2 Gene:Ube2u / 381534 MGIID:3588216 Length:352 Species:Mus musculus


Alignment Length:134 Identity:50/134 - (37%)
Similarity:73/134 - (54%) Gaps:5/134 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRFV 73
            |.|:|:.|:.|....::..|..:::|.|.|.|.|..::..|...|.||:||::||.:.||.|:|.
Mouse     9 LEREFRELKRDTRKDITAYPVSDDMMNWKAEIEGLRNSVCEGLVFYLTLEFSQEYNSVPPNVKFT 73

  Fly    74 SKVFHPNV--YADGGICLDILQ--NRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENR 134
            :..|||||  |. |...:|.|.  .:|:..|.|.:||..:|.|||.|...:|.|..||||...|.
Mouse    74 TIPFHPNVDPYT-GKPSIDFLDKPGKWNTNYTVLSILLDLQMLLSYPVLKNPVNLEAAQLLIRNA 137

  Fly   135 REYE 138
            ..|:
Mouse   138 STYK 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 50/134 (37%)
Ube2uNP_001028945.2 COG5078 1..146 CDD:227410 50/134 (37%)
UBCc 8..146 CDD:238117 50/134 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0419
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.