DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and CG40045

DIOPT Version :9

Sequence 1:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster


Alignment Length:154 Identity:56/154 - (36%)
Similarity:90/154 - (58%) Gaps:14/154 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LMRDFKRLQEDPPTGVS-GAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRF 72
            |.:....|.::|..|.| |...:|:|..|..:|.||.||.:|.|.||..:.|.:|||.:||.::|
  Fly    10 LKKQLAELNKNPVEGFSAGLIDENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEYPLRPPRMKF 74

  Fly    73 VSKVFHPNVYADGGICLDIL-------------QNRWSPTYDVSAILTSIQSLLSDPNPNSPANS 124
            |::::|||:..:|.:|:.||             ..||.|.:.|..||.|:.|:|:|||..||||.
  Fly    75 VTEIWHPNIEKNGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISVISMLADPNDESPANV 139

  Fly   125 TAAQLYKENRREYEKRVKACVEQS 148
            .||:.::|:..:::::|..||.:|
  Fly   140 DAAKEWRESYTDFKRKVARCVRKS 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 53/149 (36%)
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 53/149 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438061
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24067
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.