DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and CG5440

DIOPT Version :10

Sequence 1:NP_524230.2 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_608594.2 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster


Alignment Length:141 Identity:57/141 - (40%)
Similarity:84/141 - (59%) Gaps:0/141 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNK 66
            |..|.:|:.::...:..|||...|..|.::|:..|.:.|.||.|:.:|:|.|||.|.|..|||..
  Fly    19 SNSAVKRIQKELDEITRDPPQYCSAGPKEDNLYEWTSTIIGPADSVYENGIFKLDIFFPVEYPFA 83

  Fly    67 PPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYK 131
            ||.|.|.:.::|.|::..|.||||||:.:|||...:|.||.||.|||:|.||..|..:.....|.
  Fly    84 PPVVIFRTPIYHCNIHRLGFICLDILKEKWSPALTISKILLSICSLLTDCNPKDPLMAKIGTEYL 148

  Fly   132 ENRREYEKRVK 142
            :||.|::|:.:
  Fly   149 KNRAEHDKKAR 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_524230.2 UBCc_UBE2A_2B 3..145 CDD:467410 56/140 (40%)
CG5440NP_608594.2 UBCc_UBE2E 24..164 CDD:467413 55/136 (40%)

Return to query results.
Submit another query.