DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and Ube2a

DIOPT Version :9

Sequence 1:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001013955.1 Gene:Ube2a / 298317 RGDID:1359534 Length:162 Species:Rattus norvegicus


Alignment Length:161 Identity:133/161 - (82%)
Similarity:142/161 - (88%) Gaps:10/161 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFED----------GTFKL 55
            |||||||||||||||||||||.||||||::||||:||||||||..|||||          |||||
  Rat     1 MSTPARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFEDGTHVETTGQLGTFKL 65

  Fly    56 TIEFTEEYPNKPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNS 120
            ||||||||||||||||||||:|||||||||.|||||||||||||||||:|||||||||.:|||||
  Rat    66 TIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNS 130

  Fly   121 PANSTAAQLYKENRREYEKRVKACVEQSFID 151
            ||||.|||||:||:|||||||.|.||||:.|
  Rat   131 PANSQAAQLYQENKREYEKRVSAIVEQSWRD 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 121/146 (83%)
Ube2aNP_001013955.1 UQ_con 8..155 CDD:395127 121/146 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 252 1.000 Domainoid score I2024
eggNOG 1 0.900 - - E2759_KOG0419
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 274 1.000 Inparanoid score I2898
OMA 1 1.010 - - QHG54755
OrthoDB 1 1.010 - - D1292821at2759
OrthoFinder 1 1.000 - - FOG0001694
OrthoInspector 1 1.000 - - otm45133
orthoMCL 1 0.900 - - OOG6_101178
Panther 1 1.100 - - LDO PTHR24067
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1087
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.