DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and Ube2s

DIOPT Version :9

Sequence 1:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001099694.1 Gene:Ube2s / 292588 RGDID:1564746 Length:223 Species:Rattus norvegicus


Alignment Length:140 Identity:46/140 - (32%)
Similarity:75/140 - (53%) Gaps:0/140 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVR 71
            |.:.::...|..|||.|:...|.:.::......|.||..||:..|.|::.:...:::|..||...
  Rat    14 RLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGY 78

  Fly    72 FVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRRE 136
            |::|:|||||..:|.||:::|:..|:....:..:|.:|:.||..|||.|..|..|.:|..||..|
  Rat    79 FLTKIFHPNVGPNGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEE 143

  Fly   137 YEKRVKACVE 146
            |..|.:...|
  Rat   144 YAARARLLTE 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 44/136 (32%)
Ube2sNP_001099694.1 COG5078 9..153 CDD:227410 45/138 (33%)
UQ_con 16..152 CDD:278603 44/135 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..223
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.