DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and Ube2k

DIOPT Version :9

Sequence 1:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_038947644.1 Gene:Ube2k / 289623 RGDID:1311626 Length:210 Species:Rattus norvegicus


Alignment Length:136 Identity:49/136 - (36%)
Similarity:76/136 - (55%) Gaps:12/136 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DP-PTGVSGAPT----------DNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRF 72
            || |....||.|          |.|.......|.||.|||:|.|.::|.|:..|.||..||.|||
  Rat    21 DPAPFWWPGAETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRF 85

  Fly    73 VSKVFHPNVYA-DGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRRE 136
            ::|::|||:.: .|.||||||:::|:....:..:|.|:|:||:...|:.|.::..|..||:|...
  Rat    86 ITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEM 150

  Fly   137 YEKRVK 142
            :::..:
  Rat   151 FKQTAR 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 49/136 (36%)
Ube2kXP_038947644.1 UBCc 35..159 CDD:238117 43/122 (35%)
UBA_II_E2_UBE2K 173..210 CDD:270573
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.