DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and rhp6

DIOPT Version :9

Sequence 1:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_592876.1 Gene:rhp6 / 2542622 PomBaseID:SPAC18B11.07c Length:151 Species:Schizosaccharomyces pombe


Alignment Length:149 Identity:107/149 - (71%)
Similarity:129/149 - (86%) Gaps:0/149 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPN 65
            |||.|||||||||||:|:|||.|||.:|..:|:|:|||||.||.|||||||||||.:.|.|:|||
pombe     1 MSTTARRRLMRDFKRMQQDPPAGVSASPVSDNVMLWNAVIIGPADTPFEDGTFKLVLSFDEQYPN 65

  Fly    66 KPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLY 130
            |||.|:|||.:|||||||:|.:|||||||||||||||:||||||||||:|||..||||:.||||:
pombe    66 KPPLVKFVSTMFHPNVYANGELCLDILQNRWSPTYDVAAILTSIQSLLNDPNNASPANAEAAQLH 130

  Fly   131 KENRREYEKRVKACVEQSF 149
            :||::||.:||:..||.|:
pombe   131 RENKKEYVRRVRKTVEDSW 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 98/136 (72%)
rhp6NP_592876.1 COG5078 1..150 CDD:227410 107/149 (72%)
UQ_con 8..145 CDD:278603 98/136 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 218 1.000 Domainoid score I559
eggNOG 1 0.900 - - E2759_KOG0419
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 233 1.000 Inparanoid score I846
OMA 1 1.010 - - QHG54755
OrthoFinder 1 1.000 - - FOG0001694
OrthoInspector 1 1.000 - - oto100991
orthoMCL 1 0.900 - - OOG6_101178
Panther 1 1.100 - - LDO PTHR24067
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1583
SonicParanoid 1 1.000 - - X1087
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.