DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and Ube2e2

DIOPT Version :9

Sequence 1:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_017171445.1 Gene:Ube2e2 / 218793 MGIID:2384997 Length:239 Species:Mus musculus


Alignment Length:156 Identity:56/156 - (35%)
Similarity:85/156 - (54%) Gaps:15/156 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTPARRRLMRDFKRLQEDP--------------PTGVSGAPTDNNIMIWNAVIFGPHDTPFEDG 51
            :||.| :|:.::...:..||              |..:|..|..:||..|.:.|.||..:.:|.|
Mouse    77 LSTSA-KRIQKELAEITLDPPPNCRHMFYDSKWVPEALSAGPKGDNIYEWRSTILGPPGSVYEGG 140

  Fly    52 TFKLTIEFTEEYPNKPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDP 116
            .|.|.|.|:.:||.|||.|.|.::::|.|:.:.|.||||||::.|||...:|.:|.||.|||:|.
Mouse   141 VFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDC 205

  Fly   117 NPNSPANSTAAQLYKENRREYEKRVK 142
            ||..|...:.|..|..||.|:::..:
Mouse   206 NPADPLVGSIATQYMTNRAEHDRMAR 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 53/149 (36%)
Ube2e2XP_017171445.1 UQ_con 83..234 CDD:365926 53/149 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.