DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and ubc-1

DIOPT Version :9

Sequence 1:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001379774.1 Gene:ubc-1 / 177170 WormBaseID:WBGene00006701 Length:192 Species:Caenorhabditis elegans


Alignment Length:151 Identity:122/151 - (80%)
Similarity:142/151 - (94%) Gaps:0/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPN 65
            |:||:|||||||||:||||||.|||||||::||:.|.|:||||.:||||||||||::||||||||
 Worm     1 MTTPSRRRLMRDFKKLQEDPPAGVSGAPTEDNILTWEAIIFGPQETPFEDGTFKLSLEFTEEYPN 65

  Fly    66 KPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLY 130
            |||||:|:||:|||||||||.||||||||||||||||:||||||||||.:|||||||||.|||||
 Worm    66 KPPTVKFISKMFHPNVYADGSICLDILQNRWSPTYDVAAILTSIQSLLDEPNPNSPANSLAAQLY 130

  Fly   131 KENRREYEKRVKACVEQSFID 151
            :||||||||||:..||||:::
 Worm   131 QENRREYEKRVQQIVEQSWLN 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 113/136 (83%)
ubc-1NP_001379774.1 UQ_con 8..145 CDD:395127 113/136 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 250 1.000 Domainoid score I1157
eggNOG 1 0.900 - - E2759_KOG0419
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 269 1.000 Inparanoid score I1844
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54755
OrthoDB 1 1.010 - - D1292821at2759
OrthoFinder 1 1.000 - - FOG0001694
OrthoInspector 1 1.000 - - oto17267
orthoMCL 1 0.900 - - OOG6_101178
Panther 1 1.100 - - LDO PTHR24067
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1583
SonicParanoid 1 1.000 - - X1087
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.