DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and C28G1.10

DIOPT Version :9

Sequence 1:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001257066.1 Gene:C28G1.10 / 13222010 WormBaseID:WBGene00219376 Length:203 Species:Caenorhabditis elegans


Alignment Length:143 Identity:49/143 - (34%)
Similarity:76/143 - (53%) Gaps:4/143 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTPARR--RLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEY 63
            |||.::|  ..:|::........||:.....:.|||....:|.|..:||:|.|.|:|.|:..|.|
 Worm     1 MSTASKRVTNELRNYYSCVSSVDTGIRIKVIEGNIMHLKGIIKGVEETPYEGGIFELDIKIGESY 65

  Fly    64 PNKPPTVRFVSKVFHPNVYA-DGGICL-DILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTA 126
            |.|.|||:|::|::||:|.. ||.||| |:....|..:..:..:|..|||.:|:.|...|.:...
 Worm    66 PFKAPTVKFITKIWHPSVSPFDGTICLHDVDNGVWPVSMTIYKVLIVIQSWMSNFNEKEPIDVEI 130

  Fly   127 AQLYKENRREYEK 139
            .:....||..:||
 Worm   131 LEQATNNREVFEK 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 45/134 (34%)
C28G1.10NP_001257066.1 UBCc 5..149 CDD:238117 46/139 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.