DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and Ubc2

DIOPT Version :10

Sequence 1:NP_524230.2 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_317521.4 Gene:Ubc2 / 1278000 VectorBaseID:AGAMI1_006216 Length:215 Species:Anopheles gambiae


Alignment Length:107 Identity:18/107 - (16%)
Similarity:40/107 - (37%) Gaps:31/107 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 LANETGLSVRVVQVWFQ-----NQRAKIKKLNKKDS-----------------DSGDTFKHGPGS 261
            :.:..|..::::.|.|:     |:..:..|:|:|.:                 ..||:.   ...
Mosquito   217 IGSSGGAYIKLIGVPFRKLYDMNEAEEQLKMNRKSALEYNGWRTLCKVVEASLVEGDSI---VAK 278

  Fly   262 EGRSTEDIRSSDDEEESVINLDAD------EVETSETSSYTD 297
            |..|:||..|...::...:.:|..      .:|..::.|:.|
Mosquito   279 EASSSEDSVSYISQKGGTVLVDKSGEILYKHIEDDKSDSWPD 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_524230.2 UBCc_UBE2A_2B 3..145 CDD:467410
Ubc2XP_317521.4 UBCc_UBE2E 72..212 CDD:467413
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.