DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and UBE2C

DIOPT Version :9

Sequence 1:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_008950.1 Gene:UBE2C / 11065 HGNCID:15937 Length:179 Species:Homo sapiens


Alignment Length:145 Identity:60/145 - (41%)
Similarity:83/145 - (57%) Gaps:7/145 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPP 68
            |..:||.::...|......|:|..|..:|:..|...|.|...|.:||..:||::||...||...|
Human    30 PVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAP 94

  Fly    69 TVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKEN 133
            ||:|::..:||||...|.||||||:.:||..|||..||.||||||.:||.:||.|:.||:|:|..
Human    95 TVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNP 159

  Fly   134 -------RREYEKRV 141
                   :..|.|:|
Human   160 TAFKKYLQETYSKQV 174

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 59/141 (42%)