DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gnf1 and Crlf3

DIOPT Version :9

Sequence 1:NP_001014605.1 Gene:Gnf1 / 40607 FlyBaseID:FBgn0004913 Length:1008 Species:Drosophila melanogaster
Sequence 2:NP_061246.1 Gene:Crlf3 / 54394 MGIID:1860086 Length:442 Species:Mus musculus


Alignment Length:306 Identity:63/306 - (20%)
Similarity:113/306 - (36%) Gaps:90/306 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 KQVKEEKKSPK---KEHSSEEKGK-------------KEVKTSRRSSDKKEKEATKL-KYG--EK 362
            :|:||.....:   |:|.|:.||.             :||.|..:.:.|...:..|| ::|  ..
Mouse    42 RQIKESASQTRDVLKQHFSDLKGTLGKLLDERLVTLLQEVDTIEQETIKPLDDCQKLIEHGVNTA 106

  Fly   363 HDIAKH-------KVKEE-----HTSPKETKDKLNDVPAVTLKVKKEPSSQKEHPPSPRTADLKT 415
            .|:.:.       .::||     :.:.|.:..:|:.:|.|.|.|        :.|......|...
Mouse   107 DDLVREGEIAILGGIEEESDKLWNFTKKASHIQLDSLPEVPLLV--------DVPCLSAQLDDSI 163

  Fly   416 LDVVGMAWVDKH------KPTSIKEIVGQAGAA--------SNVTNHNLKLKAKQ------ERVK 460
            |::| ...:.||      .|..|:|::.:.|..        .:.|..:.:|:.::      |.|.
Mouse   164 LNIV-KDHIFKHGTVASRPPVQIEELIEKPGGIIVRWCKVDDDFTAQDYRLQFRKCTANHFEDVY 227

  Fly   461 VLHYFNFPRL-----MNWLSKWYVNHDGNKKPQRPNPWAKNDDGSFYKAALLSGPPGIGKTTTAT 520
            |.....|..|     :::..:.....||.   |..:||:                  :.:|..:|
Mouse   228 VGSETEFIVLHIDPNVDYQFRVCARGDGR---QEWSPWS------------------VPQTGHST 271

  Fly   521 LVVKE--LGFDAVEFNASDTRSKRLLKDEVSTLLSNKSLSGYFTGQ 564
            ||..|  .||:.  ::.|..|:..|..|..|:.:...|...||.||
Mouse   272 LVPHEWTTGFEG--YSLSSRRNIALRNDAESSGVLYSSAPTYFCGQ 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gnf1NP_001014605.1 COG5275 <151..358 CDD:227600 14/57 (25%)
BRCT 232..309 CDD:278934
PRK04195 421..969 CDD:235250 35/171 (20%)
AAA 506..633 CDD:278434 17/61 (28%)
RFC1 764..917 CDD:285691
Crlf3NP_061246.1 iSH2_PI3K_IA_R 17..113 CDD:304922 16/70 (23%)
FN3 181..267 CDD:238020 16/106 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23389
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.