DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opa and ZIC5

DIOPT Version :9

Sequence 1:NP_001368991.1 Gene:opa / 40605 FlyBaseID:FBgn0003002 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_149123.3 Gene:ZIC5 / 85416 HGNCID:20322 Length:639 Species:Homo sapiens


Alignment Length:514 Identity:208/514 - (40%)
Similarity:246/514 - (47%) Gaps:175/514 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 NSGYGHFNSYASRDFLLGRREAEYGVAGSAGQASAAADSMLFSGFPAQAAE-LGSGFGQHPF--- 133
            :||.||     ||||:|.|            ..||.|.:....|.|....: .|:|..|||.   
Human   164 SSGKGH-----SRDFVLRR------------DLSATAPAAAMHGAPLGGEQRSGTGSPQHPAPPP 211

  Fly   134 -------------------------------------HSHHHHHQMRMGMADAYAAG-------- 153
                                                 |.|..:.|||:|:|.|.||.        
Human   212 HSAGMFISASGTYAGPDGSGGPALFPALHDTPGAPGGHPHPLNGQMRLGLAAAAAAAAAELYGRA 276

  Fly   154 ------------------------HPY------------------------NHHGNFPT-----A 165
                                    |.|                        .||...|.     |
Human   277 EPPFAPRSGDAHYGAVAAAAAAALHGYGAVNLNLNLAAAAAAAAAGPGPHLQHHAPPPAPPPPPA 341

  Fly   166 AVHHPVVHHPSHHAMSAMH-PAGAGAFLRYMRHQPASSASSVKQEMQCLWIDPDQ-PGLVPP--- 225
            ...||..|||        | |..||||||||| ||      :|||:.|.|||||: .||.||   
Human   342 PAQHPHQHHP--------HLPGAAGAFLRYMR-QP------IKQELICKWIDPDELAGLPPPPPP 391

  Fly   226 ----------GGRKTCNKVFHSMHEIVTHLTVEHVGGPECTTHACFWVGCSRNGRPFKAKYKLVN 280
                      ||.|.|:|.|.:|||:|.|:|||||||||.::|.|||..|.|.|:||||||||:|
Human   392 PPPPPPPPPAGGAKPCSKTFGTMHELVNHVTVEHVGGPEQSSHVCFWEDCPREGKPFKAKYKLIN 456

  Fly   281 HIRVHTGEKPFACPHPGCGKVFARSENLKIHKRTHTGEKPFKCEHEGCDRRFANSSDRKKHSHVH 345
            |||||||||||.||.|||||||||||||||||||||||||||||.:||||:||||||||||||||
Human   457 HIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRKFANSSDRKKHSHVH 521

  Fly   346 TSDKPYNCRINGCDKSYTHPSSLRKHMKVHGNVDEKSPSH-GYDSEG-------------EESSS 396
            ||||||.|:|.|||||||||||||||||:|......||.. ||.|.|             ..|.|
Human   522 TSDKPYYCKIRGCDKSYTHPSSLRKHMKIHCKSPPPSPGPLGYSSVGTPVGAPLSPVLDPARSHS 586

  Fly   397 SSIITGGAQTPPSTRLD-----GSAGSSSGV-SSLSGGSGIKSSPHSIKSEPNPMHSVH 449
            |::      :|..|.|:     .::|:.|.: :..|.|:..::....|...|..:.::|
Human   587 STL------SPQVTNLNEWYVCQASGAPSHLHTPSSNGTTSETEDEEIYGNPEVVRTIH 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opaNP_001368991.1 zf_ZIC 206..253 CDD:408166 30/60 (50%)
C2H2 Zn finger 265..285 CDD:275368 15/19 (79%)
SFP1 <287..373 CDD:227516 77/85 (91%)
C2H2 Zn finger 293..315 CDD:275368 20/21 (95%)
C2H2 Zn finger 323..345 CDD:275368 18/21 (86%)
C2H2 Zn finger 353..375 CDD:275368 19/21 (90%)
ZIC5NP_149123.3 zf_ZIC 366..429 CDD:408166 32/68 (47%)
COG5048 <405..551 CDD:227381 119/145 (82%)
C2H2 Zn finger 441..461 CDD:275368 15/19 (79%)
C2H2 Zn finger 469..491 CDD:275368 20/21 (95%)
C2H2 Zn finger 499..521 CDD:275368 18/21 (86%)
C2H2 Zn finger 529..551 CDD:275368 19/21 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8980
eggNOG 1 0.900 - - E33208_3BCH8
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 341 1.000 Inparanoid score I2358
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D268347at33208
OrthoFinder 1 1.000 - - FOG0000467
OrthoInspector 1 1.000 - - otm41195
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR19818
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X217
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
99.060

Return to query results.
Submit another query.