DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment opa and ELF6

DIOPT Version :9

Sequence 1:	NP_001368991.1	Gene:	opa / 40605	FlyBaseID:	FBgn0003002	Length:	688	Species:	Drosophila melanogaster
Sequence 2:	NP_196044.2	Gene:	ELF6 / 830303	AraportID:	AT5G04240	Length:	1340	Species:	Arabidopsis thaliana

Alignment Length:	120	Identity:	42/120 - (35%)
Similarity:	61/120 - (50%)	Gaps:	12/120 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   256 TTH--ACFWVGCSRNGRPFKAKYKLVNHIRVHTGEKPFACPHPGCGKVFARSENLKIHKRTHTGE 318
            |||  .|:..||...   |::|.||..|       |...|.|.||||.|...:.|.:|:|.|..|
plant  1224 TTHPNRCYLEGCKMT---FESKAKLQTH-------KRNRCTHEGCGKKFRAHKYLVLHQRVHKDE 1278

  Fly   319 KPFKCEHEGCDRRFANSSDRKKHSHVHTSDKPYNCRINGCDKSYTHPSSLRKHMK 373
            :||:|..:||...|.....|.:|..:||.::||.|:::||..|:...|...:|.:
plant  1279 RPFECSWKGCSMTFKWQWARTEHLRLHTGERPYICKVDGCGLSFRFVSDYSRHRR 1333

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
opa	NP_001368991.1	zf_ZIC	206..253	CDD:408166
		C2H2 Zn finger	265..285	CDD:275368	6/19 (32%)
		SFP1	<287..373	CDD:227516	31/85 (36%)
		C2H2 Zn finger	293..315	CDD:275368	10/21 (48%)
		C2H2 Zn finger	323..345	CDD:275368	6/21 (29%)
		C2H2 Zn finger	353..375	CDD:275368	6/21 (29%)
ELF6	NP_196044.2	JmjN	17..50	CDD:396793
		JmjC	292..411	CDD:396791
		C2H2 Zn finger	1230..1255	CDD:275368	10/34 (29%)
		C2H2 Zn finger	1253..1275	CDD:275368	10/21 (48%)
		C2H2 Zn finger	1283..1305	CDD:275368	6/21 (29%)
		C2H2 Zn finger	1313..1333	CDD:275368	6/19 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000