DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opa and ZNF671

DIOPT Version :9

Sequence 1:NP_001368991.1 Gene:opa / 40605 FlyBaseID:FBgn0003002 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_079109.2 Gene:ZNF671 / 79891 HGNCID:26279 Length:534 Species:Homo sapiens


Alignment Length:191 Identity:58/191 - (30%)
Similarity:84/191 - (43%) Gaps:53/191 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 CNKVFHSMHEIVTHLTVEHVGGP--ECTTHACFW------------------VGCSRNGRPFKAK 275
            |.|.|...:::..|.|| |.|..  ||:....|:                  ..|.:.|:.|.:|
Human   318 CGKFFSQSYDLFKHQTV-HTGERPYECSECGKFFRQISGLIEHRRVHTGERLYQCGKCGKFFSSK 381

  Fly   276 YKLVNHIRVHTGEKPFACPHPGCGKVFARSENLKIHKRTHTGEKPFKCEHEGCDRRFANSSDRKK 340
            ..|:.|..||||.:|:.|..  |||.|:|...|.:|:||||||:|::|..  |.:.|:.||....
Human   382 SNLIRHQEVHTGARPYVCSE--CGKEFSRKHTLVLHQRTHTGERPYECSE--CGKAFSQSSHLNV 442

  Fly   341 HSHVHTSD--------------------------KPYNCRINGCDKSYTHPSSLRKHMKVH 375
            |..:|:||                          |||.|  :.|.|::|...:|.:|.|||
Human   443 HWRIHSSDYECSRCGKAFSCISKLIQHQKVHSGEKPYEC--SKCGKAFTQRPNLIRHWKVH 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opaNP_001368991.1 zf_ZIC 206..253 CDD:408166 8/21 (38%)
C2H2 Zn finger 265..285 CDD:275368 6/19 (32%)
SFP1 <287..373 CDD:227516 35/111 (32%)
C2H2 Zn finger 293..315 CDD:275368 9/21 (43%)
C2H2 Zn finger 323..345 CDD:275368 6/21 (29%)
C2H2 Zn finger 353..375 CDD:275368 7/21 (33%)
ZNF671NP_079109.2 KRAB 49..109 CDD:214630
KRAB 49..88 CDD:279668
C2H2 Zn finger 243..269 CDD:275368
COG5048 <285..443 CDD:227381 42/129 (33%)
zf-C2H2 285..307 CDD:278523
C2H2 Zn finger 287..307 CDD:275368
zf-H2C2_2 300..324 CDD:290200 3/5 (60%)
C2H2 Zn finger 315..335 CDD:275368 6/17 (35%)
zf-H2C2_2 327..352 CDD:290200 8/25 (32%)
C2H2 Zn finger 343..363 CDD:275368 2/19 (11%)
zf-C2H2 369..391 CDD:278523 6/21 (29%)
C2H2 Zn finger 371..391 CDD:275368 6/19 (32%)
zf-C2H2 397..419 CDD:278523 9/23 (39%)
C2H2 Zn finger 399..419 CDD:275368 9/21 (43%)
zf-H2C2_2 412..436 CDD:290200 12/25 (48%)
C2H2 Zn finger 427..447 CDD:275368 6/21 (29%)
C2H2 Zn finger 453..473 CDD:275368 0/19 (0%)
zf-H2C2_2 466..490 CDD:290200 6/25 (24%)
C2H2 Zn finger 481..501 CDD:275368 7/21 (33%)
C2H2 Zn finger 509..529 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.