DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opa and ZXDC

DIOPT Version :9

Sequence 1:NP_001368991.1 Gene:opa / 40605 FlyBaseID:FBgn0003002 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_079388.3 Gene:ZXDC / 79364 HGNCID:28160 Length:858 Species:Homo sapiens


Alignment Length:748 Identity:162/748 - (21%)
Similarity:220/748 - (29%) Gaps:265/748 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 SYASRDFLLGRREAEYGVAGSAGQASAAADSMLFSGFPAQAAELGSGF-----GQHPFHSHHHHH 140
            |.|.|..||.|...:.|.....|:||..:..      ||:....|..|     ..|         
Human    34 SPARRRLLLVRGPEDGGPGARPGEASGPSPP------PAEDDSDGDSFLVLLEVPH--------- 83

  Fly   141 QMRMGMADAYAAGHPYNHHG---NFPTAAVHHPVVHHPSHHAMSAMHPAGA-------------- 188
                |.|.|.|||......|   |..:.....|  ..|:......:.||||              
Human    84 ----GGAAAEAAGSQEAEPGSRVNLASRPEQGP--SGPAAPPGPGVAPAGAVTISSQDLLVRLDR 142

  Fly   189 GAFLRYMRHQPASSASSVKQEMQCLWIDPDQPGLVPPGGR---KTCNKVFHSMHEIVTHLTVEHV 250
            |.........||::.::..:..      |...|...||.|   ..|...|...|::..|| :.|.
Human   143 GVLALSAPPGPATAGAAAPRRA------PQASGPSTPGYRCPEPQCALAFAKKHQLKVHL-LTHG 200

  Fly   251 GGP-----ECTTHACFWVGCSRNGRPFKAKYKLVNHIRVHTGEKPFACPHPGCGKVFARSENLKI 310
            ||.     :|....|.|.        |...|||..|::.|...:||.||..||||.|....|||.
Human   201 GGQGRRPFKCPLEGCGWA--------FTTSYKLKRHLQSHDKLRPFGCPVGGCGKKFTTVYNLKA 257

  Fly   311 HKRTHTGEKPFKCEHEGCDRRFANSSDRKKHSHVH-TSDKPYNCRINGCDKSYTHPSSLRKHMKV 374
            |.:.|..|..|||  |.|..||...:....|...| ..::||.|...||:|::...|:|..|.:.
Human   258 HMKGHEQESLFKC--EVCAERFPTHAKLSSHQRSHFEPERPYKCDFPGCEKTFITVSALFSHNRA 320

  Fly   375 HGNVDE------KSPSHGYDS-----------EGEE-------------SSSSSIITGGAQTPPS 409
            |....|      ...|..||.           .||.             :|.|.::....:....
Human   321 HFREQELFSCSFPGCSKQYDKACRLKIHLRSHTGERPFICDSDSCGWTFTSMSKLLRHRRKHDDD 385

  Fly   410 TR----LDGSAGSSSGVSSLSGGSGIKSSPHSIKSEPNPMHSVHLG------------ASSSGSS 458
            .|    ::|...|.:....|.|        |||         .|||            |..|..|
Human   386 RRFTCPVEGCGKSFTRAEHLKG--------HSI---------THLGTKPFECPVEGCCARFSARS 433

  Fly   459 STASSSASHL--------------------LQHQQHQHQQQQQQQQHQQQAQQQQQLTAHPSDPK 503
            |....|..|:                    .:|....|..:|..::.....|.:...:..||...
Human   434 SLYIHSKKHVQDVGAPKSRCPVSTCNRLFTSKHSMKAHMVRQHSRRQDLLPQLEAPSSLTPSSEL 498

  Fly   504 SSPA------LQLMA--------ASASA-------------------------YLP---PPLGP- 525
            |||.      :.|.|        ||.||                         .||   ..||| 
Human   499 SSPGQSELTNMDLAALFSDTPANASGSAGGSDEALNSGILTIDVTSVSSSLGGNLPANNSSLGPM 563

  Fly   526 -----------PPSHHHHPHHHQAAPSPGAAAASASMLHHN-----------------------H 556
                       |||          ..||.....:|::|...                       .
Human   564 EPLVLVAHSDIPPS----------LDSPLVLGTAATVLQQGSFSVDDVQTVSAGALGCLVALPMK 618

  Fly   557 HLLYHPAAQHHPPSDWYHTTAPSGSA---------EAMNPLNHFGHHHHHHHLMHPGA-----AT 607
            :|...|.|.....:...|.|.|:.|:         |.:.|:.           :.|.:     |.
Human   619 NLSDDPLALTSNSNLAAHITTPTSSSTPRENASVPELLAPIK-----------VEPDSPSRPGAV 672

  Fly   608 AYXEWENWWPEEA-PPPAAQPMATPTTIAGGTG 639
            .. |..:..|:.. |.||.|..|..|.::.|||
Human   673 GQQEGSHGLPQSTLPSPAEQHGAQDTELSAGTG 705

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opaNP_001368991.1 zf_ZIC 206..253 CDD:408166 12/49 (24%)
C2H2 Zn finger 265..285 CDD:275368 5/19 (26%)
SFP1 <287..373 CDD:227516 33/86 (38%)
C2H2 Zn finger 293..315 CDD:275368 11/21 (52%)
C2H2 Zn finger 323..345 CDD:275368 6/21 (29%)
C2H2 Zn finger 353..375 CDD:275368 7/21 (33%)
ZXDCNP_079388.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..127 26/113 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..174 4/28 (14%)
C2H2 Zn finger 177..199 CDD:275368 5/22 (23%)
zf-C2H2_aberr 208..353 CDD:293622 47/154 (31%)
zf-C2H2 208..232 CDD:278523 8/31 (26%)
C2H2 Zn finger 210..232 CDD:275368 8/29 (28%)
C2H2 Zn finger 240..262 CDD:275368 11/21 (52%)
C2H2 Zn finger 270..290 CDD:275368 6/21 (29%)
COG5048 <284..443 CDD:227381 36/175 (21%)
C2H2 Zn finger 299..321 CDD:275368 7/21 (33%)
C2H2 Zn finger 333..352 CDD:275368 3/18 (17%)
C2H2 Zn finger 360..382 CDD:275368 2/21 (10%)
zf-H2C2_2 375..401 CDD:290200 3/25 (12%)
C2H2 Zn finger 390..412 CDD:275368 7/38 (18%)
COG5048 391..>584 CDD:227381 41/219 (19%)
C2H2 Zn finger 420..442 CDD:275368 5/21 (24%)
Required for transcriptional activation 579..688 17/119 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 660..696 8/46 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 726..756
Interaction with CIITA 781..858
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 837..858
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157351
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.