DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opa and ZIC2

DIOPT Version :9

Sequence 1:NP_001368991.1 Gene:opa / 40605 FlyBaseID:FBgn0003002 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_009060.2 Gene:ZIC2 / 7546 HGNCID:12873 Length:532 Species:Homo sapiens


Alignment Length:529 Identity:220/529 - (41%)
Similarity:269/529 - (50%) Gaps:129/529 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NAFIEPAQHHLASYGL-----RMSPNTTASNSNAQQQQQQQLEMTQQQQQQQQQQQQQQQQDQES 63
            |.|::.|..|:.::.|     .:||..:::.::                      |........:
Human    47 NGFVDSAAAHMGAFKLNPGAHELSPGQSSAFTS----------------------QGPGAYPGSA 89

  Fly    64 AAATAAAYQNSGYGHFNSY------ASRDFLLGRR--------EAEYGV--AGSAGQASAAADS- 111
            |||.|||.......|..||      ::||||...|        ..::|:  .|:.|...|.:|: 
Human    90 AAAAAAAALGPHAAHVGSYSGPPFNSTRDFLFRSRGFGDSAPGGGQHGLFGPGAGGLHHAHSDAQ 154

  Fly   112 --MLFSGFPAQAAELGS----------GFGQHPFHSHHHHHQMRMGMADAYAAGHPYNHHG---- 160
              :||.|.|.|....||          |.....|.....:.|:.....|.|:|...:|.:|    
Human   155 GHLLFPGLPEQHGPHGSQNVLNGQMRLGLPGEVFGRSEQYRQVASPRTDPYSAAQLHNQYGPMNM 219

  Fly   161 ----NFPTAAVHHPVVHHPSHHAMSAMHPAGAGAFLRYMRHQPASSASSVKQEMQCLWIDPDQPG 221
                |...||.||   ||..||     ||   |||.||||.|      .:|||:.|.||||:|  
Human   220 NMGMNMAAAAAHH---HHHHHH-----HP---GAFFRYMRQQ------CIKQELICKWIDPEQ-- 265

  Fly   222 LVPPGGRKTCNKVFHSMHEIVTHLTVEHVGGPECTTHACFWVGCSRNGRPFKAKYKLVNHIRVHT 286
            |..|  :|:|||.|.:|||:|||::||||||||.:.|.|||..|.|.|:||||||||||||||||
Human   266 LSNP--KKSCNKTFSTMHELVTHVSVEHVGGPEQSNHVCFWEECPREGKPFKAKYKLVNHIRVHT 328

  Fly   287 GEKPFACPHPGCGKVFARSENLKIHKRTHTGEKPFKCEHEGCDRRFANSSDRKKHSHVHTSDKPY 351
            |||||.||.||||||||||||||||||||||||||:||.||||||||||||||||.|||||||||
Human   329 GEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFQCEFEGCDRRFANSSDRKKHMHVHTSDKPY 393

  Fly   352 NCRINGCDKSYTHPSSLRKHMKVHGNVDEKSPSHGYDSEGEESSS-SSIITGGAQTPPSTRL--- 412
            .|::  ||||||||||||||||||.:..:.|.|....|.|.|||: ..:::..|:...|:.|   
Human   394 LCKM--CDKSYTHPSSLRKHMKVHESSPQGSESSPAASSGYESSTPPGLVSPSAEPQSSSNLSPA 456

  Fly   413 -------------------------DGSAGSSSGVSSLSGGSGIKSSPHSIKSEPNPMHSVHLGA 452
                                     .|.||..||..|.|||.|..:....             |.
Human   457 AAAAAAAAAAAAAAVSAVHRGGGSGSGGAGGGSGGGSGSGGGGGGAGGGG-------------GG 508

  Fly   453 SSSGSSSTA 461
            ||.|.|.||
Human   509 SSGGGSGTA 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opaNP_001368991.1 zf_ZIC 206..253 CDD:408166 27/46 (59%)
C2H2 Zn finger 265..285 CDD:275368 16/19 (84%)
SFP1 <287..373 CDD:227516 75/85 (88%)
C2H2 Zn finger 293..315 CDD:275368 20/21 (95%)
C2H2 Zn finger 323..345 CDD:275368 19/21 (90%)
C2H2 Zn finger 353..375 CDD:275368 17/21 (81%)
ZIC2NP_009060.2 Necessary for interaction with MDFIC and transcriptional activation or repression. /evidence=ECO:0000250 100..255 48/171 (28%)
zf_ZIC 250..295 CDD:408166 28/54 (52%)
C2H2 Zn finger 307..327 CDD:275368 16/19 (84%)
SFP1 <329..413 CDD:227516 75/85 (88%)
C2H2 Zn finger 335..357 CDD:275368 20/21 (95%)
C2H2 Zn finger 365..387 CDD:275368 19/21 (90%)
C2H2 Zn finger 395..415 CDD:275368 17/21 (81%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 406..452 19/45 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 475..532 17/56 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 68 1.000 Domainoid score I9708
eggNOG 1 0.900 - - E33208_3BCH8
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 341 1.000 Inparanoid score I2358
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000467
OrthoInspector 1 1.000 - - otm41195
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19818
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4702
SonicParanoid 1 1.000 - - X217
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
99.080

Return to query results.
Submit another query.