DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opa and Zic5

DIOPT Version :9

Sequence 1:NP_001368991.1 Gene:opa / 40605 FlyBaseID:FBgn0003002 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_075363.1 Gene:Zic5 / 65100 MGIID:1929518 Length:622 Species:Mus musculus


Alignment Length:498 Identity:205/498 - (41%)
Similarity:249/498 - (50%) Gaps:145/498 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 AATAAAYQNSGYGHFNSYASRDFLLGRRE--------AEYGVAGSAGQASAAAD----------- 110
            |..:....:||.||     ||||:| ||:        |.:|......|.|.::.           
Mouse   157 ATNSGGGSSSGKGH-----SRDFVL-RRDLSATAPAAAMHGAPLGGEQRSGSSSPQHPTPPPHPA 215

  Fly   111 SMLFSGFPAQAAELGSGF-------------GQHPFHSHHHHHQMRMGMADAYAAG--------- 153
            .|..|.....|...|.|.             |.||.:.     |||:|:|.|.||.         
Mouse   216 GMFISASGTYAGRDGGGSALFPALHDSPGAPGGHPLNG-----QMRLGLAAAAAAAAELYGRAEP 275

  Fly   154 ----------------------HPY---NHHGNFPTAAV------------HH-----------P 170
                                  |.|   |.:.|...||.            ||           |
Mouse   276 PFAPRSGDAHYGAVAAAAAAALHGYGAVNLNLNLAAAAAAAAAAGPGPHLQHHAPPPAPPPAPAP 340

  Fly   171 VVHHPSHHAMSAMH-PAGAGAFLRYMRHQPASSASSVKQEMQCLWIDPDQ---PGLVPPGGRKTC 231
            ..|||        | |..||||||||| ||      :|:|:.|.|:||::   |......|.|.|
Mouse   341 HPHHP--------HLPGAAGAFLRYMR-QP------IKRELICKWLDPEELAGPPASADSGVKPC 390

  Fly   232 NKVFHSMHEIVTHLTVEHVGGPECTTHACFWVGCSRNGRPFKAKYKLVNHIRVHTGEKPFACPHP 296
            :|.|.:|||:|.|:|||||||||.::|.|||..|.|.|:||||||||:||||||||||||.||.|
Mouse   391 SKTFGTMHELVNHVTVEHVGGPEQSSHVCFWEDCPREGKPFKAKYKLINHIRVHTGEKPFPCPFP 455

  Fly   297 GCGKVFARSENLKIHKRTHTGEKPFKCEHEGCDRRFANSSDRKKHSHVHTSDKPYNCRINGCDKS 361
            ||||||||||||||||||||||||||||.:||||:||||||||||||||||||||.|:|.|||||
Mouse   456 GCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRKFANSSDRKKHSHVHTSDKPYYCKIRGCDKS 520

  Fly   362 YTHPSSLRKHMKVHGNVDEKSP-SHGYDSEG-------------EESSSSSIITGGAQTPPSTRL 412
            ||||||||||||:|......|| :.||.|.|             ..|.||::      :|..|.|
Mouse   521 YTHPSSLRKHMKIHCKSPPPSPGALGYSSVGTPVGDPLSPVLDPTRSRSSTL------SPQVTNL 579

  Fly   413 D-----GSAGSSSGV-SSLSGGSGIKSSPHSIKSEPNPMHSVH 449
            :     .::|:.|.: :..|.|:..:|....:...|..|.::|
Mouse   580 NEWYVCQASGAPSHLHTPSSNGTTSESEDEEMYGNPEVMRTIH 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opaNP_001368991.1 zf_ZIC 206..253 CDD:408166 23/49 (47%)
C2H2 Zn finger 265..285 CDD:275368 15/19 (79%)
SFP1 <287..373 CDD:227516 77/85 (91%)
C2H2 Zn finger 293..315 CDD:275368 20/21 (95%)
C2H2 Zn finger 323..345 CDD:275368 18/21 (86%)
C2H2 Zn finger 353..375 CDD:275368 19/21 (90%)
Zic5NP_075363.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..171 5/18 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..223 5/32 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..251 3/18 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 321..349 7/35 (20%)
COG5048 <388..550 CDD:227381 124/161 (77%)
C2H2 Zn finger 424..444 CDD:275368 15/19 (79%)
zf-H2C2_2 437..463 CDD:290200 22/25 (88%)
C2H2 Zn finger 452..474 CDD:275368 20/21 (95%)
zf-H2C2_2 466..493 CDD:290200 23/26 (88%)
C2H2 Zn finger 482..504 CDD:275368 18/21 (86%)
zf-C2H2 510..534 CDD:278523 20/23 (87%)
C2H2 Zn finger 512..534 CDD:275368 19/21 (90%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 531..573 12/47 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 590..622 6/31 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8938
eggNOG 1 0.900 - - E33208_3BCH8
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 339 1.000 Inparanoid score I2352
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D268347at33208
OrthoFinder 1 1.000 - - FOG0000467
OrthoInspector 1 1.000 - - otm43260
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR19818
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X217
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.060

Return to query results.
Submit another query.