DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opa and iec1

DIOPT Version :9

Sequence 1:NP_001368991.1 Gene:opa / 40605 FlyBaseID:FBgn0003002 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_594663.1 Gene:iec1 / 2542854 PomBaseID:SPAC144.02 Length:249 Species:Schizosaccharomyces pombe


Alignment Length:187 Identity:50/187 - (26%)
Similarity:77/187 - (41%) Gaps:42/187 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 KQEMQCLWIDPDQPGLVPPGGRKTCNKVFHSMH-------EIVTHLT--VEHVGG--PECTTHAC 260
            :.|..|.|...:|..|       |.:.:.|.:|       .:::::.  ::|:|.  |:.|   |
pombe    21 ESETICHWQSCEQDLL-------TLDNLVHHIHNGTTSNLRLISNINSILDHIGNRRPKYT---C 75

  Fly   261 FWVGCSRNGRPFKAKYKLVNHIRVHTGEKPFACPHPGCGKVFARSENLKIHKRTHTGEKPFKCEH 325
            .|..|.|.|....:::.||.|:|.|||||||.|..|.|.:.|.||:.|..|.||         .|
pombe    76 EWDDCPRKGMVQTSRFALVAHLRSHTGEKPFICSVPECDRSFTRSDALAKHMRT---------VH 131

  Fly   326 EGCDRRFANSSDRKKHSHVHTSDKPYNCRINGCDKSYTHPSSLRKHMKVH--GNVDE 380
            |....|   .||....:|........|..:....::       |...::|  ||.:|
pombe   132 EADTLR---PSDPIPKAHPMHPQNVANAMVQSAREA-------RAQQQMHGVGNTNE 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opaNP_001368991.1 zf_ZIC 206..253 CDD:408166 10/56 (18%)
C2H2 Zn finger 265..285 CDD:275368 7/19 (37%)
SFP1 <287..373 CDD:227516 23/85 (27%)
C2H2 Zn finger 293..315 CDD:275368 9/21 (43%)
C2H2 Zn finger 323..345 CDD:275368 6/21 (29%)
C2H2 Zn finger 353..375 CDD:275368 1/21 (5%)
iec1NP_594663.1 COG5048 1..>249 CDD:227381 50/187 (27%)
zf-H2C2_2 92..119 CDD:290200 15/26 (58%)
C2H2 Zn finger 108..129 CDD:275368 8/20 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000467
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X217
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.