| Sequence 1: | NP_001368991.1 | Gene: | opa / 40605 | FlyBaseID: | FBgn0003002 | Length: | 688 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_653358.2 | Gene: | Zfp180 / 246279 | RGDID: | 631380 | Length: | 727 | Species: | Rattus norvegicus |
| Alignment Length: | 260 | Identity: | 82/260 - (31%) |
|---|---|---|---|
| Similarity: | 111/260 - (42%) | Gaps: | 56/260 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 125 GSGFGQHPFHSHHHHHQMRMGMADAYAAGHPY--NHHGNFPTAAVHHPVVHHPSHHAMSAMHP-- 185
Fly 186 -AGAGAFLRYMR--HQPASSASSVKQEMQCLWIDPDQPGLVPPGGRKTCNKVFHSMHEIVTHLTV 247
Fly 248 EHVGGP--ECTTHACFWVGCSRNGRPFKAKYKLVNHIRVHTGEKPFACPHPGCGKVFARSENLKI 310
Fly 311 HKRTHTGEKPFKCEHEGCDRRFANSSDRKKHSHVHTSDKPYNCRINGCDKSYTHPSSLRKHMKVH 375
Fly 376 375 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| opa | NP_001368991.1 | zf_ZIC | 206..253 | CDD:408166 | 7/46 (15%) |
| C2H2 Zn finger | 265..285 | CDD:275368 | 7/19 (37%) | ||
| SFP1 | <287..373 | CDD:227516 | 41/85 (48%) | ||
| C2H2 Zn finger | 293..315 | CDD:275368 | 10/21 (48%) | ||
| C2H2 Zn finger | 323..345 | CDD:275368 | 6/21 (29%) | ||
| C2H2 Zn finger | 353..375 | CDD:275368 | 8/21 (38%) | ||
| Zfp180 | NP_653358.2 | C2H2 Zn finger | 368..384 | CDD:275368 | |
| COG5048 | 369..723 | CDD:227381 | 82/260 (32%) | ||
| zf-C2H2 | 390..412 | CDD:278523 | 6/24 (25%) | ||
| C2H2 Zn finger | 392..412 | CDD:275368 | 6/24 (25%) | ||
| zf-H2C2_2 | 404..429 | CDD:290200 | 8/30 (27%) | ||
| C2H2 Zn finger | 420..440 | CDD:275368 | 8/21 (38%) | ||
| zf-H2C2_2 | 432..457 | CDD:290200 | 6/26 (23%) | ||
| C2H2 Zn finger | 448..468 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 461..485 | CDD:290200 | 6/42 (14%) | ||
| C2H2 Zn finger | 476..496 | CDD:275368 | 5/36 (14%) | ||
| zf-H2C2_2 | 492..513 | CDD:290200 | 9/31 (29%) | ||
| C2H2 Zn finger | 504..524 | CDD:275368 | 9/29 (31%) | ||
| zf-H2C2_2 | 520..541 | CDD:290200 | 12/22 (55%) | ||
| C2H2 Zn finger | 532..552 | CDD:275368 | 10/21 (48%) | ||
| zf-H2C2_2 | 545..568 | CDD:290200 | 13/24 (54%) | ||
| C2H2 Zn finger | 560..580 | CDD:275368 | 6/21 (29%) | ||
| zf-H2C2_2 | 573..597 | CDD:290200 | 11/25 (44%) | ||
| C2H2 Zn finger | 588..608 | CDD:275368 | 8/21 (38%) | ||
| zf-H2C2_2 | 600..625 | CDD:290200 | 3/9 (33%) | ||
| C2H2 Zn finger | 616..636 | CDD:275368 | |||
| zf-H2C2_2 | 629..653 | CDD:290200 | |||
| C2H2 Zn finger | 644..664 | CDD:275368 | |||
| zf-H2C2_2 | 659..680 | CDD:290200 | |||
| C2H2 Zn finger | 672..692 | CDD:275368 | |||
| zf-H2C2_2 | 685..707 | CDD:290200 | |||
| C2H2 Zn finger | 700..720 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||