DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opa and ZXDB

DIOPT Version :9

Sequence 1:NP_001368991.1 Gene:opa / 40605 FlyBaseID:FBgn0003002 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_009088.1 Gene:ZXDB / 158586 HGNCID:13199 Length:803 Species:Homo sapiens


Alignment Length:745 Identity:147/745 - (19%)
Similarity:219/745 - (29%) Gaps:295/745 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 SAAATAAAYQNSGYGHFNSYASRDFLLGRREAEYGVAGSAGQASAAADSMLFSGFPAQAAELGSG 127
            ||...|||:..:...|     ::|.||   ..|.||             :..:..|..|.|.|:.
Human   157 SAPGPAAAFAGTVTIH-----NQDLLL---RFENGV-------------LTLATPPPHAWEPGAA 200

  Fly   128 FGQHPFHSHHHHHQMRMGMADAYAAGHPY-NHHGNF-----------PTAAVHHPVVHHPSHHAM 180
            ..|.|            |...|..||.|: .|.|:.           |......|.....:....
Human   201 PAQQP------------GCLIAPQAGFPHAAHPGDCPELPPDLLLAEPAEPAPAPAPEEEAEGPA 253

  Fly   181 SAMHPAGAGAFLRYMRHQPASSASSVKQEMQCLWIDPDQPGLVPPGGRKTCNKVFHSMHEIVTHL 245
            :|:.|.|           |..|...|     .|::.|:          ..|.:.|...|::..||
Human   254 AALGPRG-----------PLGSGPGV-----VLYLCPE----------AQCGQTFAKKHQLKVHL 292

  Fly   246 TVEHVGGP-----ECTTHACFWVGCSRNGRPFKAKYKLVNHIRVHTGEKPFACPHPGCGKVFA-- 303
             :.|....     :|....|.|.        |...|||..|::.|...:||.||..||||.|.  
Human   293 -LTHSSSQGQRPFKCPLGGCGWT--------FTTSYKLKRHLQSHDKLRPFGCPAEGCGKSFTTV 348

  Fly   304 ----------RSEN--------------------------------------------------- 307
                      ..||                                                   
Human   349 YNLKAHMKGHEQENSFKCEVCEESFPTQAKLSAHQRSHFEPERPYQCAFSGCKKTFITVSALFSH 413

  Fly   308 ---------------------------LKIHKRTHTGEKPFKCEHEGCDRRFANSSDRKKHSHVH 345
                                       ||||.|:||||:||.|:.:||...|.:.|...:|...|
Human   414 NRAHFREQELFSCSFPGCSKQYDKACRLKIHLRSHTGERPFLCDFDGCGWNFTSMSKLLRHKRKH 478

  Fly   346 TSDKPYNCRINGCDKSYTHPSSLRKHMKVH-GNVDEKSPSHGYDSEGEESSS---------SSII 400
            ..|:.:.|.:.||.||:|....|:.|...| |......|..|..:.....||         ..:.
Human   479 DDDRRFMCPVEGCGKSFTRAEHLKGHSITHLGTKPFVCPVAGCCARFSARSSLYIHSKKHLQDVD 543

  Fly   401 TGGAQTPPSTRLDGSAGSSSGVSSLSGGSGIKSSPHSIKSEPNPMHSVH---LGASSSGSSSTAS 462
            |..::.|                 :|..:.:.:|.||:|:.....|.|.   |....:.:|.|.|
Human   544 TWKSRCP-----------------ISSCNKLFTSKHSMKTHMVKRHKVGQDLLAQLEAANSLTPS 591

  Fly   463 SSASHLLQHQQHQHQQQQQQQQHQQQAQQQQQLTAHPSDPKSSPA------------LQLMAASA 515
            |..:                .|.|......:.::.....|.|:.|            |.:..||.
Human   592 SELT----------------SQRQNDLSDAEIVSLFSDVPDSTSAALLDTALVNSGILTIDVASV 640

  Fly   516 SAYLPPPLGPPPSHHHHPHHHQAAPSPGAAAASASMLHHNHHLLYHPAAQHHPP----SDWYHTT 576
            |:.|   .|..|:::::        |.|.|....|::           |...||    :..:..|
Human   641 SSTL---AGHLPANNNN--------SVGQAVDPPSLM-----------ATSDPPQSLDTSLFFGT 683

  Fly   577 APSG-----------SAEAMNPLNHFGHHHHHHHLMHPGAATAYXEWENWWPEEAPPPAAQPMAT 630
            |.:|           |:.::.||               |:..:.  .:|..||   |.|..|.:.
Human   684 AATGFQQSSLNMDEVSSVSVGPL---------------GSLDSLA-MKNSSPE---PQALTPSSK 729

  Fly   631 PTTIAGGTGPAQGSVEESASSL------DW 654
            .|.......|:....|.|.|.|      :|
Human   730 LTVDTDALTPSSTLCENSVSELLTPTKAEW 759

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opaNP_001368991.1 zf_ZIC 206..253 CDD:408166 9/46 (20%)
C2H2 Zn finger 265..285 CDD:275368 5/19 (26%)
SFP1 <287..373 CDD:227516 38/175 (22%)
C2H2 Zn finger 293..315 CDD:275368 14/111 (13%)
C2H2 Zn finger 323..345 CDD:275368 6/21 (29%)
C2H2 Zn finger 353..375 CDD:275368 8/21 (38%)
ZXDBNP_009088.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..91
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..140
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..260 6/41 (15%)
Required for interaction with ZXDC. /evidence=ECO:0000250 271..577 69/341 (20%)
C2H2 Zn finger 273..295 CDD:275368 6/32 (19%)
zf-C2H2_aberr 304..449 CDD:293622 25/152 (16%)
zf-C2H2 304..328 CDD:278523 8/31 (26%)
C2H2 Zn finger 306..328 CDD:275368 8/29 (28%)
C2H2 Zn finger 336..358 CDD:275368 7/21 (33%)
zf-H2C2_2 350..373 CDD:290200 2/22 (9%)
zf-C2H2 364..386 CDD:278523 0/21 (0%)
C2H2 Zn finger 366..386 CDD:275368 0/19 (0%)
C2H2 Zn finger 395..417 CDD:275368 0/21 (0%)
C2H2 Zn finger 429..448 CDD:275368 5/18 (28%)
COG5048 <441..572 CDD:227381 40/147 (27%)
C2H2 Zn finger 456..478 CDD:275368 6/21 (29%)
zf-H2C2_2 471..497 CDD:290200 8/25 (32%)
C2H2 Zn finger 486..508 CDD:275368 8/21 (38%)
C2H2 Zn finger 516..538 CDD:275370 4/21 (19%)
Required for transcriptional activation. /evidence=ECO:0000250 576..703 28/164 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157349
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.