DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gmppb and rffH

DIOPT Version :10

Sequence 1:NP_649498.1 Gene:Gmppb / 40599 FlyBaseID:FBgn0037279 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_418236.1 Gene:rffH / 948299 ECOCYCID:EG11454 Length:293 Species:Escherichia coli


Alignment Length:253 Identity:68/253 - (26%)
Similarity:128/253 - (50%) Gaps:17/253 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RALILVGGYGTRLRPLTLSTPKPLVEFANKPILLHQLEALVDAGCRQVILAVSYRAEQMEKELKV 76
            :.:||.||.||||.|:|....|.|:...:||::.:.|..|:.||.|::::..:...:...:.|..
E. coli     2 KGIILAGGSGTRLHPITRGVSKQLLPIYDKPMIYYPLSVLMLAGIREILIITTPEDKGYFQRLLG 66

  Fly    77 EAKKLGVELIFSHETEPLGTAGPLALAKTILAASSEP-FFVLNSDVICDFPFKQLVQFHCNHGKE 140
            :..:.|::|.::.:..|.|.|....:.:|.|  :.|| ..||..::.....|...::......:.
E. coli    67 DGSEFGIQLEYAEQPSPDGLAQAFIIGETFL--NGEPSCLVLGDNIFFGQGFSPKLRHVAARTEG 129

  Fly   141 GTIVVTKVEEPSKYGVVLYDENGCIKNFIEKPQEFVSNKINAGIYIFNPSVLDRI-EVKPTSIEK 204
            .|:...:|.:|.::|||.:|:|....:..|||::..||....|:|.::..|::.. :||| |...
E. coli   130 ATVFGYQVMDPERFGVVEFDDNFRAISLEEKPKQPKSNWAVTGLYFYDSKVVEYAKQVKP-SERG 193

  Fly   205 EVFPEMTQQQELY--AMDLT------GF-WMDIGQPKDFLTGMCLYLSSLRQKQSPKL 253
            |:  |:|...::|  |.:||      || |:|.| ..|.|.....::.::.::|..|:
E. coli   194 EL--EITSINQMYLEAGNLTVELLGRGFAWLDTG-THDSLIEASTFVQTVEKRQGFKI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GmppbNP_649498.1 M1P_guanylylT_B_like_N 12..242 CDD:133047 66/240 (28%)
LbetaH 264..343 CDD:469633
rffHNP_418236.1 rmlA 2..287 CDD:130274 68/253 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.