DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1129 and APS2

DIOPT Version :9

Sequence 1:NP_001189177.2 Gene:CG1129 / 40599 FlyBaseID:FBgn0037279 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001322344.1 Gene:APS2 / 837066 AraportID:AT1G05610 Length:482 Species:Arabidopsis thaliana


Alignment Length:429 Identity:81/429 - (18%)
Similarity:157/429 - (36%) Gaps:103/429 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ALILVGGYGTRLRPLTLSTPKPLVEF-ANKPILLHQLEALVDAGCRQVILAVSYRAEQMEKELKV 76
            |::..||..:.|.|||.:..|..:.. ||..::...:...:::|..::.....:.:..:...|..
plant    57 AIVFGGGSDSELYPLTKTRSKGAIPIAANYRLIDAVISNCINSGITKIYAITQFNSTSLNSHLSK 121

  Fly    77 EAKKLG------VELIFSHETEP-----LGTAGPLALAKTILAASSEP---FFVLNSDVICDFPF 127
            .....|      ||:|.::::..     .|||.  |:.:.:......|   |.||....:....:
plant   122 AYSGFGLGKDRFVEVIAAYQSLEDQGWFQGTAD--AIRRCLWVFEEFPVTEFLVLPGHHLYKMDY 184

  Fly   128 KQLVQFHCNHGKEGTIV----VTKVEEPSKYGVVLYDENGCIKNFIEKPQE---FVSNKI----- 180
            |.|::.|.....:.|||    ||  :....:|.:..|....:..|..|.|:   .|:|:.     
plant   185 KMLIEDHRRSRADITIVGLSSVT--DHDFGFGFMEVDSTNAVTRFTIKGQQDLISVANRTATRSD 247

  Fly   181 --------NAGIYIFN----PSVLDRIEVKPTSIEKEVFP-EMTQQQELYAMDLTGFWMDIGQPK 232
                    :||||:..    ..:|....:|...:..|:.| .:::..::.|....|:|.|:....
plant   248 GTSSCSVPSAGIYVIGREQMVKLLRECLIKSKDLASEIIPGAISEGMKVKAHMFDGYWEDVRSIG 312

  Fly   233 DFLTGMCLYLSSLR--------QKQSPKLYTGPGVVG----NVLVDPTAKIGEGC---------- 275
            .:.......:...|        .:|.| |||.|..:.    :|.|...:.||:||          
plant   313 AYYRANMESIKRCRLDLNYRFYDRQCP-LYTMPRCLPPSSMSVAVITNSIIGDGCILDKCVIRGS 376

  Fly   276 RIGPNVTIGPDVVIEDGVC--------------------------------IKRSTILKGAIVRS 308
            .:|....|..:|::||.:.                                |:|:.:.|.|.:..
plant   377 VVGMRTRIADEVIVEDSIIVGSDIYEMEEDVRRKGKEKKIEIRIGIGEKSRIRRAIVDKNARIGK 441

  Fly   309 HSWL---DSCIVGWRSTVGRWVRIEGITVLGEDVIVKDE 344
            :..:   |:...|.|...|..:| |||.::..:.::.::
plant   442 NVMIINRDNVEEGNREAQGYVIR-EGIIIILRNAVIPND 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1129NP_001189177.2 GCD1 12..361 CDD:224129 81/429 (19%)
M1P_guanylylT_B_like_N 12..242 CDD:133047 51/268 (19%)
LbetaH 264..343 CDD:294107 22/123 (18%)
APS2NP_001322344.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D806744at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.