DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1129 and AT2G04650

DIOPT Version :9

Sequence 1:NP_001189177.2 Gene:CG1129 / 40599 FlyBaseID:FBgn0037279 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_178542.2 Gene:AT2G04650 / 815007 AraportID:AT2G04650 Length:406 Species:Arabidopsis thaliana


Alignment Length:411 Identity:123/411 - (29%)
Similarity:212/411 - (51%) Gaps:67/411 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ALILVGG--YGTRLRPLTLSTPKPLVEFANKPILLHQLEALVDAGCRQV-----ILAVSYRAEQ- 69
            |:|:|||  .|||.|||:.:|||||:..|.:|::.|.:.|     |:::     |..:.:..|: 
plant     8 AVIMVGGPTKGTRFRPLSFNTPKPLIPLAGQPMIHHPISA-----CKKISNLAQIFLIGFYEERE 67

  Fly    70 -------MEKELKVEAKKLGVELIFSHETEPLGTAGPLALAK-TILAASSEPFFVLNSDVICDFP 126
                   :..|||:..:.|       .|.:|.|:||.|...: .|:.......|:||.||.|.||
plant    68 FALYVSSISNELKIPVRYL-------KEDKPHGSAGALYYFRDRIMEEKPSHVFLLNCDVCCSFP 125

  Fly   127 FKQLVQFHCNHGKEGTIVVTKV--EEPSKYGVVLYD-ENGCIKNFIEKPQEFVSNKINAGIYIFN 188
            .:.::..|..:|..||::|.||  |..|::|.::.| :...:.::.|||:.|||:.||.|:|:|.
plant   126 LQGILDAHRRYGGIGTMLVIKVSAEAASQFGELIADPDTKELLHYTEKPETFVSDLINCGVYVFT 190

  Fly   189 PSVLDRIE-----VKPTS----------------IEKEVFPEMTQQQELYAMDLTGFWMDIGQPK 232
            ..:.:.||     ::.||                :::::...:..:::||..:...||..|..|.
plant   191 SDIFNAIEEVYSQIRDTSSNYQSATRSVPADFVRLDQDILSPLAGKKQLYTYENKDFWEQIKTPG 255

  Fly   233 DFLTGMCLYLSSLRQKQSPKLYTG------PGVVGNVLVDPTAKIGEGCRIGPNVTIGPDVVIED 291
            ..|....||||..|:.....|.:|      |.::|:|.:.|:.|:....:|||||:|..:|.:..
plant   256 KSLKCSALYLSQFRETSPHILASGDGTNRKPTIIGDVYIHPSVKLHPTAKIGPNVSISANVRVGP 320

  Fly   292 GVCIKRSTILKGAIVRSHSWLDSCIVGWRSTVGRWVRIE---------GITVLGEDVIVKDELYI 347
            ||.:....||....::.::.:.:.|:||:|::|||.|::         |||:|||.|.|:||:.:
plant   321 GVRLISCIILDDVEIKENAVVINSIIGWKSSIGRWSRVQASGDYNDRLGITILGEAVTVEDEVAV 385

  Fly   348 NGGQVLPHKSIAASVPEPQII 368
            .|..||.:|::..||.:..|:
plant   386 IGSIVLQNKTLNVSVQDDIIL 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1129NP_001189177.2 GCD1 12..361 CDD:224129 120/402 (30%)
M1P_guanylylT_B_like_N 12..242 CDD:133047 76/268 (28%)
LbetaH 264..343 CDD:294107 29/87 (33%)
AT2G04650NP_178542.2 M1P_guanylylT_A_like_N 8..264 CDD:133050 75/267 (28%)
LbetaH 294..381 CDD:381831 29/86 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D806744at2759
OrthoFinder 1 1.000 - - FOG0000664
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.