DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1129 and zgc:136439

DIOPT Version :9

Sequence 1:NP_001189177.2 Gene:CG1129 / 40599 FlyBaseID:FBgn0037279 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001035462.1 Gene:zgc:136439 / 678627 ZFINID:ZDB-GENE-060421-2858 Length:274 Species:Danio rerio


Alignment Length:282 Identity:75/282 - (26%)
Similarity:120/282 - (42%) Gaps:61/282 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RALILVGGYGTRL-RPLTLST----------PKPLVEFANKPILLHQLEALVDAGCRQVILAVS- 64
            :|:||..|||||| |.:.:.|          .|||:...:..::.|.|:||...||...:..|: 
Zfish     2 KAVILAAGYGTRLQRDIEIDTTGKFKHLKGIAKPLLPVGSCALISHWLQALTKTGCVDTVYVVTN 66

  Fly    65 ---YRA-EQMEKELKVEAKKLGVELIFSHETEPLGTAGPLA-LAKTI-LAASSEPFFVLNSDVIC 123
               :.| :|..:|..      .|::|...........|.:| |..|| |.|..:...|:..|.:.
Zfish    67 DLHHEAFQQWAQEFP------NVKIINDGTRRNKDRHGAVACLQLTIKLCAVDDDLLVIGGDTLF 125

  Fly   124 --DFPFKQLVQ--FHC-NHGKEGTIVVT---KVEEPSKYGVVLYDEN---GCIKNFIEKPQEFVS 177
              ||..:...:  |.. :..||..:|:.   |.||.||||::..||:   .|:|   |||....:
Zfish   126 KEDFSLRTFTERFFEVQSKDKESNLVLAYRCKDEETSKYGILELDEDLKVQCLK---EKPLLSET 187

  Fly   178 NKINA--GIYIFNPSVLDRIEV-----KPTSIEKEVFPE-----MTQQQELYAMDLTGFWMDIGQ 230
            |..:|  ..|:|:.:.|..:||     |...||:...|.     :..::.:|...::|.: |:|.
Zfish   188 NSRDACPCFYLFSKTSLPLLEVFLNEKKNNPIEERDAPGTFLSWLILRKPVYVHRISGRF-DVGN 251

  Fly   231 P----------KDFLTGMCLYL 242
            .          ||.|....:||
Zfish   252 LASYVECDKYFKDQLQNSAVYL 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1129NP_001189177.2 GCD1 12..361 CDD:224129 75/282 (27%)
M1P_guanylylT_B_like_N 12..242 CDD:133047 73/280 (26%)
LbetaH 264..343 CDD:294107
zgc:136439NP_001035462.1 GCD1 1..>269 CDD:224129 73/276 (26%)
Glyco_tranf_GTA_type 3..250 CDD:299700 69/256 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.