DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1129 and CG8207

DIOPT Version :9

Sequence 1:NP_001189177.2 Gene:CG1129 / 40599 FlyBaseID:FBgn0037279 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_611051.2 Gene:CG8207 / 36730 FlyBaseID:FBgn0034035 Length:438 Species:Drosophila melanogaster


Alignment Length:434 Identity:123/434 - (28%)
Similarity:189/434 - (43%) Gaps:89/434 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RALILVGG--YGTRLRPLTLSTPKPLVEFANKPILLHQLEALVD-AGCRQVILAVSYRAEQME-- 71
            :|:||:||  .|||.|||:|.|||||...|.:|::.|.:||... ...|::::...|...|||  
  Fly     3 KAVILIGGPQKGTRFRPLSLDTPKPLFPLAGRPLIAHHIEACAQLPDIREILIIGYYPQTQMEGF 67

  Fly    72 -KELKVEAKKLGVELIFSHETEPLGTAGPL-ALAKTILAASSEPFFVLNSDVICDFPFKQLVQFH 134
             .:::.......:.:.:..|...|||||.: .....|.|.:...|||||.||..|||.::|..||
  Fly    68 VGDMQALYSSSNINIRYLQEFTALGTAGGMYHFRDQIRAGNPRAFFVLNGDVCADFPLQELCDFH 132

  Fly   135 CNHGKEGTIVVTKVE----EPSKYGVVLYD-ENGCIKNFIEKPQEFVSNKINAGIYIFNP---SV 191
            ........:.:...|    :...||.:::| .:|.:.:::|||..:||..||.|:|:.:.   :|
  Fly   133 EKRPASALVTIMSTEATRQQSLHYGCLVFDRSSGAVSHYVEKPSSYVSTFINCGVYVCSMDIFTV 197

  Fly   192 LDRI-----------------------EVKPTSIEKEVFPEMTQQQELYAMDLTGFWMDIGQPKD 233
            |.:|                       |......|:||...:....:|:||.:..:|..:.    
  Fly   198 LAQIFHSRGQEYSCQAFCNGNGNGNGREQGHIKWEQEVLTPLAGTDKLFAMPVPNWWSQLK---- 258

  Fly   234 FLTGMCLYLS----SLRQKQSPKLYTGPG-------------VVGNVLVDPTAKIGEGCRIGPNV 281
             ..|..:|.:    .|.:|..|:.....|             |..:|.|.|:|.:.....:||||
  Fly   259 -TAGSAIYANRHYLGLYKKTHPERLANVGIKRGEGDGSLICTVHPDVYVHPSATVHHSAVLGPNV 322

  Fly   282 TIGPDVVIEDGVCIKRSTILKGAIVRSHSWLDSCIVGWRSTVGRWVRIEG--------------- 331
            .|||.|.|..||.|:.|.:|:.|.:..|:.:...|||..||:|.|.|:||               
  Fly   323 AIGPGVTIGPGVRIRESIVLEQAQILDHTLVLHSIVGRGSTIGAWARVEGTPSDPDPNKPFAKME 387

  Fly   332 --------------ITVLGEDVIVKDELYINGGQVLPHKSIAAS 361
                          ||:||..|.|..|..:....|||||.::.|
  Fly   388 NPPLFNNEGKLNPSITILGCFVQVPAEKILLNSIVLPHKELSRS 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1129NP_001189177.2 GCD1 12..361 CDD:224129 122/432 (28%)
M1P_guanylylT_B_like_N 12..242 CDD:133047 74/267 (28%)
LbetaH 264..343 CDD:294107 35/107 (33%)
CG8207NP_611051.2 GCD1 1..366 CDD:224129 105/367 (29%)
M1P_guanylylT_A_like_N 4..270 CDD:133050 75/270 (28%)
LbetaH 306..372 CDD:294107 27/65 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456492
Domainoid 1 1.000 84 1.000 Domainoid score I429
eggNOG 1 0.900 - - E1_COG1208
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I353
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D336231at33208
OrthoFinder 1 1.000 - - FOG0000664
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22572
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.