DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hus1-like and MEC3

DIOPT Version :9

Sequence 1:NP_001262267.1 Gene:Hus1-like / 40598 FlyBaseID:FBgn0026417 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_013391.1 Gene:MEC3 / 850995 SGDID:S000004279 Length:474 Species:Saccharomyces cerevisiae


Alignment Length:328 Identity:62/328 - (18%)
Similarity:105/328 - (32%) Gaps:138/328 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 DQSSAASPLVWAGITAEEYFPEYRMEAAHPDQEYIVLG-----------VSSANLGRALSVLRGG 99
            |.:|..:|:...|||.||.     :..:.|:...::.|           |.:.||..:..|:   
Yeast   145 DTTSKPNPICALGITFEEI-----VHTSGPNDAIVMNGGVDEHNGLPTTVGTGNLLASNKVI--- 201

  Fly   100 GVNSCKLKLQ--------RIQFPCISVIASV---LTSSSTEAREVVH------------------ 135
             ::|.|:.::        |||.|.|:.|..:   |...|.|.....|                  
Yeast   202 -MHSFKVPVKLLFRAQDTRIQEPMINYIQLMMYKLPPISGEFGSAFHGFIRRVERYSNVNHIHLM 265

  Fly   136 ------------DVPVTIIPGS-DWSAYVVPRVPNSQLALGLPSLRLLKSLIDKLKNI--SPSLE 185
                        ||.:.||... ||...:....|             |.|:|.:.:.:  :||..
Yeast   266 GVKKKEHGNEGDDVELKIIVNELDWHLEICWNGP-------------LDSVIQRQEGLTDNPSQN 317

  Fly   186 FQVNVD-----GELNVI-ATSEMSTVTS-----------RFQKLLIR------------------ 215
            ..::.|     |.|.:| |...||::.:           |:.:.|:|                  
Yeast   318 QHIDTDGRQEEGSLPIIEADKPMSSLYTNTRDREMEENIRYDEDLLRIEDSSIADTRGNIYTADT 382

  Fly   216 -----------TVSGSQQEAS--------CSVDSRKASAFFGALQLPNEELTIGIDREHS--IHL 259
                       .|..::||:|        |. |.:..|..:.|.    ||:.:.|..:.|  .|.
Yeast   383 SGDTEFNDISVMVEKAEQESSSTHEVIIRCK-DWKVCSKLYAAF----EEVVLAISHDESCVFHC 442

  Fly   260 QID 262
            .:|
Yeast   443 SLD 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hus1-likeNP_001262267.1 Hus1 1..277 CDD:281934 62/328 (19%)
MEC3NP_013391.1 Hus1 1..468 CDD:397902 62/328 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12900
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.