DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hus1-like and LTO1

DIOPT Version :9

Sequence 1:NP_001262267.1 Gene:Hus1-like / 40598 FlyBaseID:FBgn0026417 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001334465.1 Gene:LTO1 / 72284 MGIID:1919534 Length:161 Species:Mus musculus


Alignment Length:44 Identity:14/44 - (31%)
Similarity:19/44 - (43%) Gaps:11/44 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QDPLYMKEFQAIVA----------TLTKLAKDCVMILGS-RQMH 40
            :|...||..:|::|          |..||.:|...|.|. ||.|
Mouse    88 KDSRKMKVVEALIALLQDFPYDDPTYEKLHEDLDRIRGKFRQYH 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hus1-likeNP_001262267.1 Hus1 1..277 CDD:281934 14/44 (32%)
LTO1NP_001334465.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12900
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.