powered by:
Protein Alignment Hus1-like and LTO1
DIOPT Version :9
Sequence 1: | NP_001262267.1 |
Gene: | Hus1-like / 40598 |
FlyBaseID: | FBgn0026417 |
Length: | 278 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001334465.1 |
Gene: | LTO1 / 72284 |
MGIID: | 1919534 |
Length: | 161 |
Species: | Mus musculus |
Alignment Length: | 44 |
Identity: | 14/44 - (31%) |
Similarity: | 19/44 - (43%) |
Gaps: | 11/44 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 QDPLYMKEFQAIVA----------TLTKLAKDCVMILGS-RQMH 40
:|...||..:|::| |..||.:|...|.|. ||.|
Mouse 88 KDSRKMKVVEALIALLQDFPYDDPTYEKLHEDLDRIRGKFRQYH 131
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Hus1-like | NP_001262267.1 |
Hus1 |
1..277 |
CDD:281934 |
14/44 (32%) |
LTO1 | NP_001334465.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR12900 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.