DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hus1-like and Hus1b

DIOPT Version :9

Sequence 1:NP_001262267.1 Gene:Hus1-like / 40598 FlyBaseID:FBgn0026417 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001128318.1 Gene:Hus1b / 691382 RGDID:1585035 Length:276 Species:Rattus norvegicus


Alignment Length:293 Identity:76/293 - (25%)
Similarity:136/293 - (46%) Gaps:36/293 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFRALMQDPLYMKEFQAIVATLTKLAKDCVMILGSRQMHF----IVNEDQSSAASPLVWAGITA 61
            |||||.:....:::.|..:.:|:.||.|.||:.:...::.|    :::|.:       :| |...
  Rat     1 MKFRARITSKRFIELFIQVNSTIAKLTKVCVLRVCPDRLCFCPMGLLSEAK-------LW-GEVR 57

  Fly    62 EEYFPEYRMEAAHPDQEYIVLGVSSANLGRALSVLRGGGVNSCKLKLQRIQFPCISVIASVLTSS 126
            ...|..:.||....:...|.|.::|.:|.||  |......:|.||:|.....||::|:.. |.|.
  Rat    58 RNVFHHFCMEGVSQEFNEIYLELTSEHLARA--VRNASNASSLKLQLTNKLRPCLTVVVE-LASC 119

  Fly   127 STEAREVVHDVPVTIIPGSDWSAYVVPRVPNSQLALGLPSLRLLKSLIDKLKNISPSLEFQVNVD 191
            ....|.:|||:||.::|...|.....|.|..|.:::.||:::.||::::::.|:...:..:.|:.
  Rat   120 PGHTRAMVHDLPVRVLPRRWWKECTEPHVRGSDVSVYLPAMKTLKNMVERMANVGSHVLVEANLK 184

  Fly   192 GELNVIATSEMSTVTSRFQKLLIRTVSGSQQEA--------------SCSVDSRKASAFFGALQL 242
            |::|:...::..|:.|.|:.|      ||...|              ...||:||...||...|:
  Rat   185 GKMNLSVETDGVTIKSYFRNL------GSPPNAVLGMSQGKDPDNMVQVRVDNRKLLRFFDGQQI 243

  Fly   243 PNEELTIGIDREHSIHLQIDVRQDVVLHSILPA 275
            ........|.....:||.: |.:|:.|...:||
  Rat   244 NPTMALCNILSNTLLHLVL-VHEDISLQYFIPA 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hus1-likeNP_001262267.1 Hus1 1..277 CDD:281934 76/293 (26%)
Hus1bNP_001128318.1 Hus1 1..276 CDD:281934 76/293 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343341
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.