DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hus1-like and hus1

DIOPT Version :9

Sequence 1:NP_001262267.1 Gene:Hus1-like / 40598 FlyBaseID:FBgn0026417 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001006827.1 Gene:hus1 / 448560 XenbaseID:XB-GENE-983295 Length:282 Species:Xenopus tropicalis


Alignment Length:286 Identity:83/286 - (29%)
Similarity:148/286 - (51%) Gaps:15/286 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFRALMQDPLYMKEFQAIVATLTKLAKDCVMILGSRQMHFIVNEDQSSAASPLVWAGITAEEYF 65
            |:||:.:.|...:..|..::.|::||.|.|.:.|....::||:. |:.:.....:|..::...:|
 Frog     1 MRFRSKIVDVSCLNHFTRVINTISKLTKTCTLRLTVNNLYFILT-DKVANGGVSMWCELSQGNFF 64

  Fly    66 PEYRMEAAHPDQEYIVLGVSSANLGRALSVLRGGGVNSCKLKLQRIQFPCISVIASVLTSSSTEA 130
            .||:||....:|..|.|.:...||.|||...:  ...|.|:||.....||::| |..|.|.|:.:
 Frog    65 DEYQMEGVCMEQNEIFLELIPENLSRALKTAQ--NAKSVKVKLTNKHCPCLTV-ALELPSLSSSS 126

  Fly   131 REVVHDVPVTIIPGSDWSAYVVPRVPNSQLALGLPSLRLLKSLIDKLKNISPSLEFQVNVDGELN 195
            |.|.||:||::||...|:.:..|.||...:::.||:|:.:||:::::||:|..:..:.|.:||:|
 Frog   127 RIVTHDIPVSVIPRRLWNDFKEPSVPEFDVSIYLPALKTMKSVVERMKNLSNYIVIEANRNGEIN 191

  Fly   196 VIATSEMSTVTSRFQKL------LIRTVSGSQQE----ASCSVDSRKASAFFGALQLPNEELTIG 250
            :...:::.:|::.|:.|      .......|.||    |...:|.||...|....|:...:....
 Frog   192 LKIETDLVSVSTHFKDLGNPPWVSDDASQNSTQEIDNMAEARIDIRKLLQFLAGQQVNPTKAICN 256

  Fly   251 IDREHSIHLQIDVRQDVVLHSILPAV 276
            |..:..:|. |.:.:||.|...:||:
 Frog   257 IVHKRMVHF-ILLHEDVSLQYFIPAL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hus1-likeNP_001262267.1 Hus1 1..277 CDD:281934 83/286 (29%)
hus1NP_001006827.1 Hus1 1..282 CDD:367769 83/286 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 122 1.000 Domainoid score I5595
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37932
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54444
OrthoDB 1 1.010 - - D1053181at2759
OrthoFinder 1 1.000 - - FOG0003934
OrthoInspector 1 1.000 - - oto103678
Panther 1 1.100 - - LDO PTHR12900
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.030

Return to query results.
Submit another query.