powered by:
Protein Alignment Hus1-like and Lto1
DIOPT Version :9
Sequence 1: | NP_001262267.1 |
Gene: | Hus1-like / 40598 |
FlyBaseID: | FBgn0026417 |
Length: | 278 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001101035.1 |
Gene: | Lto1 / 309136 |
RGDID: | 1304637 |
Length: | 222 |
Species: | Rattus norvegicus |
Alignment Length: | 57 |
Identity: | 16/57 - (28%) |
Similarity: | 24/57 - (42%) |
Gaps: | 10/57 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 LAKDCVMILGSRQMHFIVNEDQSSAASPLVWAGITAEEYFP--EYRMEAAHPDQEYI 80
||..|::..|: .::.|....:|.|.||..:.|| :...|..|.|.|.|
Rat 146 LAWKCLLHSGA--------GEKESRKMKVVEALITLLQDFPYDDPTYEKLHEDLERI 194
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Hus1-like | NP_001262267.1 |
Hus1 |
1..277 |
CDD:281934 |
16/57 (28%) |
Lto1 | NP_001101035.1 |
Yae1_N |
107..145 |
CDD:286849 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR12900 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.