DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hus1-like and Hus1

DIOPT Version :9

Sequence 1:NP_001262267.1 Gene:Hus1-like / 40598 FlyBaseID:FBgn0026417 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_006514594.1 Gene:Hus1 / 15574 MGIID:1277962 Length:300 Species:Mus musculus


Alignment Length:274 Identity:82/274 - (29%)
Similarity:146/274 - (53%) Gaps:16/274 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFRALMQDPLYMKEFQAIVATLTKLAKDCVMILGSRQMHFIVNEDQSSAASPLVWAGITAEEYF 65
            |||||.:.|...:..|..:...:.||||.|.:.:...:::||:. |:.::....:|..:..|.:|
Mouse     1 MKFRAKIVDLACLNHFTRVSNMIAKLAKTCTLRISPEKLNFILC-DKLASGGVSMWCELEQENFF 64

  Fly    66 PEYRMEAAHPDQEYIVLGVSSANLGRALSVLRGGGVNSCKLKLQRIQFPCISVIASVLTSSSTEA 130
            .|::||....:...|.|.::|.||.|||...:..  .:.|:||....|||::|...:..|||:.:
Mouse    65 SEFQMEGVSEENNEIYLELTSENLSRALKTAQNS--RALKIKLTNKHFPCLTVSVELQVSSSSSS 127

  Fly   131 REVVHDVPVTIIPGSDWSAYVVPRVPNSQLALGLPSLRLLKSLIDKLKNISPSLEFQVNVDGELN 195
            |.||||:|:.::|...|.....|.:|:..:::.||:|:::||:::|::|||..|..:.|:.||||
Mouse   128 RIVVHDIPIKVLPRRLWKDLQEPSIPDCDVSICLPALKMMKSVVEKMRNISNQLVIEANLKGELN 192

  Fly   196 VIATSEMSTVTSRFQKL---LIRTVSGSQQE-----ASCSVDSRKASAFFGALQL-PNE----EL 247
            :...:|:..||:.|:.|   |:.:.|.||..     |...:|.:|...|....|: |.:    |.
Mouse   193 LKIETELVCVTTHFKDLENPLLPSDSVSQNRHPEDMAKVHIDIKKLLQFLAGQQVTPTKAVCSEF 257

  Fly   248 TIGIDREHSIHLQI 261
            ...:.....:|:|:
Mouse   258 ASPLSTSFVLHMQV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hus1-likeNP_001262267.1 Hus1 1..277 CDD:281934 82/274 (30%)
Hus1XP_006514594.1 Hus1 1..285 CDD:367769 82/274 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839522
Domainoid 1 1.000 144 1.000 Domainoid score I4587
eggNOG 1 0.900 - - E1_KOG3999
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37932
Inparanoid 1 1.050 144 1.000 Inparanoid score I4420
Isobase 1 0.950 - 0 Normalized mean entropy S5411
OMA 1 1.010 - - QHG54444
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003934
OrthoInspector 1 1.000 - - otm43327
orthoMCL 1 0.900 - - OOG6_102922
Panther 1 1.100 - - LDO PTHR12900
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R579
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.740

Return to query results.
Submit another query.