DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctrip and BAG3

DIOPT Version :9

Sequence 1:NP_001189170.1 Gene:ctrip / 40596 FlyBaseID:FBgn0260794 Length:3140 Species:Drosophila melanogaster
Sequence 2:NP_004272.2 Gene:BAG3 / 9531 HGNCID:939 Length:575 Species:Homo sapiens


Alignment Length:393 Identity:84/393 - (21%)
Similarity:132/393 - (33%) Gaps:139/393 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly  1653 TQLTDPNNPICANPSPKPLSATATPTANAG----GSQSAPA----------------------SA 1691
            ::.|..|:|...:..||     .||::..|    ||:..||                      .|
Human    44 SRTTTWNDPRVPSEGPK-----ETPSSANGPSREGSRLPPAREGHPVYPQLRPGYIPIPVLHEGA 103

  Fly  1692 NSLQVNPFFMDSAPGL-----SSASTTPSSSKHQSYSVKSFSH---AMNALTASAKGTP------ 1742
            .:.||:||.:...||:     .:|:..|..|:.....:...:.   ....:.|:|...|      
Human   104 ENRQVHPFHVYPQPGMQRFRTEAAAAAPQRSQSPLRGMPETTQPDKQCGQVAAAAAAQPPASHGP 168

  Fly  1743 -----SGALDATSSSTTAGGYNYSSSAPSSSSGAPAAYFVTQQGDPRQY-----VHFQQPAVPAP 1797
                 ..|.|.:|||:       |:|.|||...:..::.:     ||.|     :|.|....||.
Human   169 ERSQSPAASDCSSSSS-------SASLPSSGRSSLGSHQL-----PRGYISIPVIHEQNVTRPAA 221

  Fly  1798 PP-----QQELLPSGVQQQGQ-QVPQVIY---QPHHQQPAHLVLA----STSSGAASSSSSSSSS 1849
            .|     |:...|:   |||: |..|.:|   |....:|..|..|    |:..||:|...|.:.|
Human   222 QPSFHQAQKTHYPA---QQGEYQTHQPVYHKIQGDDWEPRPLRAASPFRSSVQGASSREGSPARS 283

  Fly  1850 S----SASALQ-HKMTD-----MLKRKAPPKRKSQSGGRAK------------------------ 1880
            |    |.|.:: |.:.|     |..|:..|..:.::...:|                        
Human   284 STPLHSPSPIRVHTVVDRPQQPMTHRETAPVSQPENKPESKPGPVGPELPPGHIPIQVIRKEVDS 348

  Fly  1881 ----------SRQEDAAVAPA-------GSGPGGAPPSSSGSAMHELLSRATSLGSGNGGRSTPN 1928
                      |.:.:..|.||       ..||...|.|....|..|..:.:|:     ...:||.
Human   349 KPVSQKPPPPSEKVEVKVPPAPVPCPPPSPGPSAVPSSPKSVATEERAAPSTA-----PAEATPP 408

  Fly  1929 SGG 1931
            ..|
Human   409 KPG 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctripNP_001189170.1 Extensin_2 <688..731 CDD:252669
WWE 1409..1481 CDD:128922
FAM199X <1985..2074 CDD:292442
HECTc <2818..3138 CDD:294058
BAG3NP_004272.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..92 12/52 (23%)
WW 21..53 CDD:197736 2/8 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..200 16/83 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..421 36/177 (20%)
BAG 421..498 CDD:214591
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 532..575
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.